KEGG   Capsicum annuum (peppers): 107849353
Entry
107849353         CDS       T04646                                 
Name
(RefSeq) SKP1-like protein 20
  KO
K03094  S-phase kinase-associated protein 1
Organism
cann  Capsicum annuum (peppers)
Pathway
cann03083  Polycomb repressive complex
cann04120  Ubiquitin mediated proteolysis
cann04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cann00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    107849353
   04120 Ubiquitin mediated proteolysis
    107849353
  09126 Chromosome
   03083 Polycomb repressive complex
    107849353
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:cann04131]
    107849353
   04121 Ubiquitin system [BR:cann04121]
    107849353
   03036 Chromosome and associated proteins [BR:cann03036]
    107849353
Membrane trafficking [BR:cann04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    107849353
Ubiquitin system [BR:cann04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     107849353
   Cul7 complex
     107849353
Chromosome and associated proteins [BR:cann03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     107849353
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     107849353
SSDB
Motif
Pfam: Skp1
Other DBs
NCBI-GeneID: 107849353
NCBI-ProteinID: XP_047257484
LinkDB
Position
12:complement(26160690..26162255)
AA seq 92 aa
MKKLKEAASSRLKKSNSIAASKKKFEDSGRLCLPKATNYLNIKSLLDLTCQTVTDMIKGK
TPEEIRKTFNIKNNFTPEEEEEVGRETAWAFE
NT seq 279 nt   +upstreamnt  +downstreamnt
atgaagaaattgaaggaagcggccagttccagattgaagaagtcaaattcaatagcggcc
agtaagaagaagtttgaagattccggtcgactatgtcttccgaaggctaccaactatttg
aacatcaagagcctgctagatctcacctgtcagactgtgactgacatgatcaaaggaaag
actccagaggagattcgcaagaccttcaacatcaagaataacttcacacctgaagaggaa
gaggaggtcgggagagagactgcttgggcctttgagtaa

DBGET integrated database retrieval system