Capsicum annuum (peppers): 107857194 Help Entry 107857194         CDS       T04646                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism cann  Capsicum annuum (peppers) Pathway cann04145   Phagosome cann04148   Efferocytosis cann04517   IgSF CAM signaling cann04518   Integrin signaling cann04620   Toll-like receptor signaling pathway cann05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:cann00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     107857194    04518 Integrin signaling     107857194  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     107857194    04148 Efferocytosis     107857194  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     107857194  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     107857194  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cann04131]     107857194   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cann04147]     107857194    04031 GTP-binding proteins [BR:cann04031]     107857194 Membrane trafficking [BR:cann04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     107857194  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     107857194   Macropinocytosis    Ras GTPases     107857194  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     107857194 Exosome [BR:cann04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    107857194   Exosomal proteins of other body fluids (saliva and urine)    107857194   Exosomal proteins of colorectal cancer cells    107857194   Exosomal proteins of bladder cancer cells    107857194 GTP-binding proteins [BR:cann04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     107857194 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C B12-binding AAA_7 Motif Other DBs NCBI-GeneID:  107857194 NCBI-ProteinID:  XP_016557617 UniProt:  A0A1U8FE95 LinkDB All DBs Position 1:201895511..201899417 Genome browser AA seq 210 aa AA seqDB search MNTSTTSASNNATASSGTKFIKCVTVGDGAVGKTCLLISYTSNTFPTDYVPTVFDNFSAN VNVDGKIVNLGLWDTAGQEDYNRLRPLSYRGADVFLLAFSLISRPSFENISKKWVPELRH YAPSVPIVLVGTKLDLREDKQFRRDYPGACTISTEQGEELKKQIGAVAYVECSAKTQQNV KAVFDTAIKVVLQPPKSKKQKRKHKACWIL NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgaatactagtactactagtgctagtaataatgctactgcaagtagtggaacaaagttc atcaaatgtgtcacagttggagatggtgctgttggaaaaacttgccttctcatctcctac actagcaacacttttcccactgattatgtgccaactgtttttgacaatttcagtgccaat gtcaatgtggatgggaagattgtgaatctcggactgtgggatactgctgggcaagaggat tataacaggcttaggcctcttagttatcgaggagcagatgtcttcctgctggctttctct ctcataagtaggcctagctttgaaaacatatcaaaaaagtgggttcctgagctaagacat tatgccccatcagtgcctattgttctagtggggactaagttggatttaagagaggacaag cagtttagaagggactaccctggtgcatgtacaatttcaacagaacagggtgaagaactg aaaaagcaaataggtgcagtggcatatgttgagtgcagcgccaagacacagcagaatgtg aaggcggtttttgatactgcaatcaaggtggttcttcagcctccaaagtccaaaaagcag aaaagaaaacacaaagcttgctggatactttga

DBGET integrated database retrieval system