Capsicum annuum (peppers): 107871478 Help Entry 107871478         CDS       T04646                                  Name (RefSeq) ubiquitin isoform X1   KO K03873   elongin-B Organism cann  Capsicum annuum (peppers) Pathway cann04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cann00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     107871478  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cann04121]     107871478    03400 DNA repair and recombination proteins [BR:cann03400]     107871478 Ubiquitin system [BR:cann04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      107871478    Cul5 complex      107871478 DNA repair and recombination proteins [BR:cann03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      107871478 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD UBL_UBAC1 Dsc3_N Ubiquitin_2 Pet127 DUF7909 Motif Other DBs NCBI-GeneID:  107871478 NCBI-ProteinID:  XP_016573909 LinkDB All DBs Position 5:220825408..220832688 Genome browser AA seq 104 aa AA seqDB search MAMYIRVKRNKTTYFIQCDPTETILQIKEKLYNLIDQPANDQRLILMPAGHVLEDSKSLA DQNVENDAVLALTLRKDDNEFEDVNIVKPNDFYQNRDSEAGANW NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atggcaatgtatatccgtgtgaagcgtaataagaccacctactttattcaatgtgatcca accgagacaattctacaaataaaggagaaattgtataacctcatagatcaacctgctaat gatcagcgattaatcctcatgcctgctggacacgtgttggaagactcgaagtccctagct gatcagaatgttgaaaatgacgctgtgctggcgctgactctgagaaaagatgacaatgaa ttcgaggatgtaaatatcgtgaaacctaatgacttttaccagaaccgcgattcagaagct ggtgcaaattggtga

DBGET integrated database retrieval system