Kaistella antarctica: NCTC13489_01891 Help Entry NCTC13489_01891   CDS       T06886                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism cant  Kaistella antarctica Pathway cant01100   Metabolic pathways cant01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:cant00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     NCTC13489_01891    00074 Mycolic acid biosynthesis     NCTC13489_01891   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     NCTC13489_01891 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  VEH99982 UniProt:  A0A3S4V321 LinkDB All DBs Position 1:complement(2074446..2074682) Genome browser AA seq 78 aa AA seqDB search MTNEEILEKLTGIFHEELDNEEIVLSRETTADDIEEWDSLSHIQLIVAVEKAFKIRFTSS EIQSWNNVGEMIDCILSK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgaccaacgaagaaattttagagaagctgacagggattttccatgaagaattagataat gaagaaattgtgttaagcagagaaaccactgcagatgacatcgaagaatgggattcttta tcgcatattcagctgatcgtggcggtagaaaaagcttttaaaatcagatttacttcctca gaaatccaaagctggaataatgtcggagaaatgatcgactgtattttatctaaataa

DBGET integrated database retrieval system