Magallana angulata (Portugese oyster): 128177102 Help Entry 128177102         CDS       T09348                                  Name (RefSeq) cdc42 homolog   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism canu  Magallana angulata (Portugese oyster) Pathway canu04145   Phagosome canu04148   Efferocytosis canu04310   Wnt signaling pathway canu04517   IgSF CAM signaling canu04518   Integrin signaling canu04620   Toll-like receptor signaling pathway canu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:canu00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     128177102   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     128177102    04518 Integrin signaling     128177102  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     128177102    04148 Efferocytosis     128177102  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     128177102  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     128177102  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:canu04131]     128177102   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:canu04147]     128177102    04031 GTP-binding proteins [BR:canu04031]     128177102 Membrane trafficking [BR:canu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     128177102  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     128177102   Macropinocytosis    Ras GTPases     128177102  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     128177102 Exosome [BR:canu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128177102   Exosomal proteins of other body fluids (saliva and urine)    128177102   Exosomal proteins of colorectal cancer cells    128177102   Exosomal proteins of bladder cancer cells    128177102 GTP-binding proteins [BR:canu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     128177102 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Matrix_Pneumo_N Motif Other DBs NCBI-GeneID:  128177102 NCBI-ProteinID:  XP_052699611 LinkDB All DBs Position 3:5344429..5345556 Genome browser AA seq 185 aa AA seqDB search MVVSVNKSLQCSVVGDGFVGKSCLVERFLGGEFNSEYVATLQDDYIAKCNVNGDSLEMNI TDFAGEHDDLVSIEVPDVFVVCFSLVDKDSLESVLNFWVPRIRSEEKQTPIVLVGTQLDK RRTQRKGHISTEEGLSLAQSISASAYVECSAKDNTGVDVALYSILLASNKCSRRKASLFK RVLGR NT seq 558 nt NT seq  +upstreamnt  +downstreamnt atggttgtttctgtgaacaagtctctgcagtgttcggttgttggagacggatttgtgggg aagtcgtgtcttgttgagcgatttcttggtggagaatttaacagcgaatatgtggccact ctccaagatgactacattgcaaagtgcaacgttaatggcgacagcttagagatgaatatt acggacttcgctggagagcatgacgaccttgtctccatcgaagtgcctgatgtctttgtt gtctgctttagccttgttgacaaggactcgctcgaaagcgtgctcaacttctgggttcca agaataagatccgaagagaagcaaacgcccatcgtcttagtcggaacccagctagacaag agaagaacacaaagaaagggccatatttctaccgaagaagggctcagtctcgctcagtct atcagcgcttcagcctacgtggaatgttcggcgaaagacaacacaggggtggatgttgcg ctttacagcatccttctggcgagcaacaagtgtagcagaaggaaagccagtctcttcaaa cgcgttcttggcagatga

DBGET integrated database retrieval system