Magallana angulata (Portugese oyster): 128178522 Help Entry 128178522         CDS       T09348                                  Name (RefSeq) rho-related protein racD-like   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism canu  Magallana angulata (Portugese oyster) Pathway canu04145   Phagosome canu04148   Efferocytosis canu04310   Wnt signaling pathway canu04620   Toll-like receptor signaling pathway canu05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:canu00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     128178522  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     128178522    04148 Efferocytosis     128178522  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     128178522  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     128178522  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:canu04131]     128178522   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:canu04147]     128178522    04031 GTP-binding proteins [BR:canu04031]     128178522 Membrane trafficking [BR:canu04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     128178522  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     128178522   Macropinocytosis    Ras GTPases     128178522  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     128178522 Exosome [BR:canu04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    128178522   Exosomal proteins of other body fluids (saliva and urine)    128178522   Exosomal proteins of colorectal cancer cells    128178522   Exosomal proteins of bladder cancer cells    128178522 GTP-binding proteins [BR:canu04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     128178522 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU SRPRB TniB AAA_22 DUF1366 Motif Other DBs NCBI-GeneID:  128178522 NCBI-ProteinID:  XP_052701688 LinkDB All DBs Position 3:complement(33722406..33723883) Genome browser AA seq 196 aa AA seqDB search MRRRIQCSIVGETMVGKTTLLKSYVTCKPPEIYSPTIYDNIKGSVVLGKKKYKVNLVDTA GQHEYSNLCTATYKKSRVIILCYSVIDRQSFDRIKTFWIPELRKNLGKRVPIVLTATHTD LRNDKYIKRCIEVVSSSEGKQLADSFGAKGFYEISRSNISQTNDIFECAVKAVVGEKRTL FTIFKKVFCNTRRNKN NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgaggagaagaattcaatgtagcattgttggagagacaatggttggaaaaactaccctt ttgaaatcttatgtcacgtgcaaaccgccagaaatctattcgccaacaatttacgacaat atcaaaggatctgtcgttcttggcaagaaaaagtacaaagtcaacctcgtggatactgca ggccagcacgagtactccaatctttgtaccgcgacttacaaaaaaagccgagtgatcatc ttatgctacagtgtgatagacagacaatcgttcgaccgaattaaaaccttctggattccc gaactccgaaagaatctgggaaaacgcgtacccattgttcttacagccacgcatacagac ctccgaaatgacaaatatatcaagagatgcatagaagtggtgtcgtctagcgaggggaaa cagttggcggacagttttggggccaagggtttttatgaaatttccagatccaacatttct caaactaatgacatttttgaatgtgccgtcaaggctgtagttggcgagaagaggacattg tttactatttttaaaaaagtattttgtaatacccgaagaaataaaaactga

DBGET integrated database retrieval system