Magallana angulata (Portugese oyster): 128190750 Help Entry 128190750         CDS       T09348                                  Name (RefSeq) elongin-B-like   KO K03873   elongin-B Organism canu  Magallana angulata (Portugese oyster) Pathway canu04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:canu00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     128190750  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:canu04121]     128190750    03400 DNA repair and recombination proteins [BR:canu03400]     128190750 Ubiquitin system [BR:canu04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      128190750    Cul5 complex      128190750 DNA repair and recombination proteins [BR:canu03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      128190750 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  128190750 NCBI-ProteinID:  XP_052718888 LinkDB All DBs Position 6:complement(16879167..16883333) Genome browser AA seq 120 aa AA seqDB search MDVFLMIRRKKTTIFTDAKESTPVSDVKKIVEGILKIRPEDQKLFKDDQPLDDNKTLGDY GFTFATARAQAPATIGLACKQDDGEFEQLEITPLSSPPELPDVMKQQDSTSAHAQEQTAS NT seq 363 nt NT seq  +upstreamnt  +downstreamnt atggatgtgttcttgatgatcagaagaaaaaagactaccatctttacagatgcaaaagag tcaaccccagttagcgatgtgaaaaaaattgtagaaggtattctaaagatcagacctgaa gatcaaaagctgttcaaagatgatcagccactagatgacaacaaaacgctaggagattat gggtttacttttgcaacagcaagagcacaagctccagctactatcggactggcttgtaaa caagatgatggcgagtttgaacagttagagatcacccccctatccagtcccccggagcta ccagatgtgatgaaacaacaagactccacatcggcacatgcacaagaacaaacagcatct taa

DBGET integrated database retrieval system