Caldilinea aerophila: CLDAP_29190
Help
Entry
CLDAP_29190 CDS
T01797
Name
(GenBank) putative LytR family transcriptional protein
KO
K01005
polyisoprenyl-teichoic acid--peptidoglycan teichoic acid transferase [EC:2.7.8.-]
Organism
cap
Caldilinea aerophila
Pathway
cap00552
Teichoic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:
cap00001
]
09100 Metabolism
09107 Glycan biosynthesis and metabolism
00552 Teichoic acid biosynthesis
CLDAP_29190
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LytR_cpsA_psr
LytR_C
Motif
Other DBs
NCBI-ProteinID:
BAM00959
UniProt:
I0I6S1
LinkDB
All DBs
Position
3624721..3626091
Genome browser
AA seq
456 aa
AA seq
DB search
MIYGLIVLTLAIIAGVYLHDWAQQRIVRSSILAELDKIVKPVEVNPALRPEAIASTGGQP
ETSAAAEPAGRVDSPAQRPVVNILLLGTDERPDEYGPPRTDTIILVSFNPNTGAVGMLSL
PRDLWVPIPALGITTKINTTYMLGELHNYPGGGAQLIKDTVSSFVGRPVDYYVRVNFDGF
RQIIDLIGGVTVEVPYTIHDEEYPTPDYGVETFHLDAGVHRLDGETALKYVRTRHGDSDY
GRARRQQDVIRAAVKQVLDAGTLPQLLARAPQLLMTMQNSVQTDLPIQLAIELAGRLQEQ
GQGNIEQLVLDNRYGEETFSSEGAWILLPDRARVRTALNAFFAAVDAPPGAEKTAVTNPA
SVRIEILNGTSQPEAAERAAQFLQKQGWQITSIGQADRSDYLQTIVINYGVADSVAAMVS
SQLNLDADQAQINGLAASAPVDIRIVVGRDVLALLQ
NT seq
1371 nt
NT seq
+upstream
nt +downstream
nt
atgatatatgggttgattgttttgacgctggcgatcatcgccggcgtgtatctgcatgac
tgggcgcagcagcgtatagtccgctcctcgattctggctgaactggacaaaattgtgaaa
ccggtggaggttaaccctgcgcttcgaccggaagccattgcgtcaacgggagggcagccg
gagacatcagccgcagcggagccggccgggcgtgtagattcgcctgctcaacggcctgtc
gtcaacatcctgctgctgggcaccgatgaacgccctgatgaatacgggccgcctcgcaca
gacaccattattttagtctcgttcaatccgaacacgggcgccgtcggcatgctttcgctg
ccgcgcgacttatgggtgccgattccggcgctgggcatcacgaccaaaatcaacacgacc
tacatgctcggcgagcttcacaattatcccggcggtggcgcacagcttatcaaagacaca
gtcagcagttttgttggtcggccggttgattactacgtccgcgtgaactttgatggtttt
cgacagatcatcgacctgatcggcggcgttacggtcgaggtgccatatacgatccatgac
gaggaatatcccacgccagactacggcgtcgagacctttcacctggacgctggcgtacat
cgcctggacggggagacggcgttgaagtacgtgcgcacccgtcacggtgacagcgactat
ggccgcgcccggcggcagcaggatgtcatccgcgcggcggtcaaacaggtgctggatgca
ggcacgcttccgcaacttctggcaagagcgcctcagttgctaatgaccatgcagaatagt
gtccaaaccgatttgccgattcaactggcgatcgagctggccggacggttgcaggagcag
ggccaggggaatattgagcaattggtgctggacaaccgctacggcgaagagaccttcagc
agcgaaggcgcatggatcctgctgcctgaccgtgcgcgtgtgcgtacggcgctcaatgcg
ttttttgctgcagtcgatgcgccgcctggggccgaaaagacggcggtgaccaacccggcc
tccgtgcgcattgagatcctcaacgggacctcacagccggaggcagcagagcgcgcagca
caatttttgcaaaaacagggctggcagatcacttccatcggtcaggccgatcgaagcgat
tacctgcagactatcgtcatcaactatggagtggcggacagcgtggcggccatggtctcc
agccaactgaatctggacgcagatcaggcgcagatcaacgggctggcggcctcggcgccg
gtcgacatccgcatcgtcgtcggccgcgatgtgcttgcactccttcaatag
DBGET
integrated database retrieval system