Comamonas aquatica: KAQ61_01940 Help Entry KAQ61_01940       CDS       T07338                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism caqt  Comamonas aquatica Pathway caqt01100   Metabolic pathways caqt01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:caqt00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KAQ61_01940 (acpP)    00074 Mycolic acid biosynthesis     KAQ61_01940 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KAQ61_01940 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 Phage_terminase Motif Other DBs NCBI-ProteinID:  QTX21297 LinkDB All DBs Position 417533..417772 Genome browser AA seq 79 aa AA seqDB search MSDIEARVKKIIAEQLGVEESQVTNEKAFVADLGADSLDTVELVMALEDEFGIEIPDEDA EKITTVQNAIDYANTHHKA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgaagcacgtgtcaaaaaaatcattgctgaacaactcggcgttgaagag tcccaagtgaccaacgaaaaggccttcgtggctgacctgggcgctgactccctggacacg gtcgaactggtgatggccctggaagatgaattcggcatcgaaatccccgatgaagatgct gaaaagatcacgacggtgcaaaacgccatcgactacgccaacacccaccacaaggcctaa

DBGET integrated database retrieval system