Corynebacterium aquilae: CAQU_04535 Help Entry CAQU_04535        CDS       T05112                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism caqu  Corynebacterium aquilae Pathway caqu03430   Mismatch repair Brite KEGG Orthology (KO) [BR:caqu00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     CAQU_04535  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:caqu03400]     CAQU_04535 Enzymes [BR:caqu01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      CAQU_04535 DNA repair and recombination proteins [BR:caqu03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      CAQU_04535 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Motif Other DBs NCBI-ProteinID:  APT84453 UniProt:  A0A1L7CFA0 LinkDB All DBs Position complement(1039304..1039570) Genome browser AA seq 88 aa AA seqDB search MTSPDTFGSGTPAELPDPQSLSYEQARDELIETVKILELGQMSLDESLAYWERGEALARR CEQQLGAAQQRVEKALGAVDNGSSEEED NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgacttcaccagacacttttggcagcggtaccccggctgagcttccggatccgcagtcg ttgagctacgagcaggcccgtgatgagttgattgagactgtgaagattctcgagttgggt cagatgagcttggatgagtctttggcgtattgggagcgcggcgaggcgttggcgcggcgc tgcgagcagcagttgggggcggcccagcagcgggttgagaaggccttgggcgctgtggat aacggctcctcggaggaggaagactag

DBGET integrated database retrieval system