KEGG   Corynebacterium aurimucosum: cauri_0674
Entry
cauri_0674        CDS       T00887                                 
Symbol
mtrA
Name
(GenBank) two-component system response regulator
  KO
K07670  two-component system, OmpR family, response regulator MtrA
Organism
car  Corynebacterium aurimucosum
Pathway
car02020  Two-component system
Brite
KEGG Orthology (KO) [BR:car00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    cauri_0674 (mtrA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:car02022]
    cauri_0674 (mtrA)
Two-component system [BR:car02022]
 OmpR family
  MtrB-MtrA (osmotic stress response)
   cauri_0674 (mtrA)
SSDB
Motif
Pfam: Response_reg Trans_reg_C GlnR_1st
Other DBs
NCBI-ProteinID: ACP32271
UniProt: C3PEL7
LinkDB
Position
736289..736975
AA seq 228 aa
MAPKILVVDDDPAIAEMLTIVLEAEGLEPIAVNDGNEAIPAFREHDPDLILLDLMLPGMN
GVDICRAIRTESSVPIVMLTAKTDTVDVVLGLESGADDYITKPFKPKELIARIRARLRRI
DGGTGEIIEVGDLLIDVPEHTVTRKGGEEISLTPLEFDLLLEMARKPGQVHTREALLESV
WGYRHASDTRLVNVHVQRLRAKIEHDPEDPHIVLTVRGVGYKTGKVAE
NT seq 687 nt   +upstreamnt  +downstreamnt
gtggcaccgaaaatcttggtcgtggatgatgacccggcaattgccgaaatgcttaccatc
gtgctcgaggcagaagggctggagcctattgccgtcaacgatggtaatgaggccatcccg
gccttccgcgagcacgacccggatctgatcctgttggatctcatgcttccgggcatgaac
ggcgttgatatctgccgtgccatccgtaccgagtcctcggtgcctatcgtgatgctgacc
gcaaagaccgataccgtcgatgtggtccttggcctcgaatcaggggcggatgactacatc
accaagcccttcaagccgaaagagctcatcgcccgcatccgtgcgcgcctgcgccggatt
gacggaggtacaggcgaaattatcgaggtaggggacctgcttatcgacgtccccgagcac
accgtcacccgcaagggcggcgaggagatctcgctgaccccgctggagttcgacctcctg
ctggaaatggctcgaaagcccggacaggtgcacacccgcgaggcgttgctcgaatccgtc
tggggctaccgccacgcttccgatactcgcctggtcaacgtgcatgttcagcgcctgcgc
gcaaagatcgagcatgatccagaggatccgcacatcgtgctcacggtacgcggtgtggga
tacaagactggaaaagtcgccgagtaa

DBGET integrated database retrieval system