KEGG   Corynebacterium aurimucosum: cauri_1167
Entry
cauri_1167        CDS       T00887                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
car  Corynebacterium aurimucosum
Pathway
car00770  Pantothenate and CoA biosynthesis
car01100  Metabolic pathways
car01240  Biosynthesis of cofactors
Module
car_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:car00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    cauri_1167 (coaD)
Enzymes [BR:car01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     cauri_1167 (coaD)
SSDB
Motif
Pfam: CTP_transf_like Citrate_ly_lig
Other DBs
NCBI-ProteinID: ACP32760
UniProt: C3PG06
LinkDB
Position
1295697..1296173
AA seq 158 aa
MPTHAVCPGSFDPITLGHVDVFNRASELFDKVTVLVTGNPDKPSGLFSVEERVDLIRRTV
SPEIEVDWWGGLLVDYTSAHGIDTIVKGLRSSLDYEYELPMAQMNRRLSGIDTVFLLTDE
KYGYISSSLCKQVAQYGGDVTGMFPDHVAAAVMERFRG
NT seq 477 nt   +upstreamnt  +downstreamnt
atgccgacccacgccgtatgccccggctctttcgatcccatcacgctgggacacgtcgac
gtttttaatcgcgccagcgaactttttgacaaggtcacggtgctggtgacgggaaacccc
gacaagccttccgggctgtttagcgtggaggagcgcgtggacctcattcgccgtaccgtc
tccccagagatcgaggtggattggtggggcggattactggtggattacaccagtgcccat
ggcatagacacgattgtgaagggcttgcgctcctccttggactatgagtatgagctgccg
atggcgcagatgaaccggcgcctttccggaatcgatacggtcttcttgctgacggatgag
aaatacggctatatctcctcctcgctgtgcaagcaggtggcgcagtacggcggcgatgtc
acgggtatgttcccagaccacgtggcagccgcggtcatggaacgcttccgaggctaa

DBGET integrated database retrieval system