Coffea arabica (coffee): 113688431 Help Entry 113688431         CDS       T11342                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism carb  Coffea arabica (coffee) Pathway carb04517   IgSF CAM signaling carb04814   Motor proteins Brite KEGG Orthology (KO) [BR:carb00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     113688431  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     113688431  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:carb03037]     113688431    04812 Cytoskeleton proteins [BR:carb04812]     113688431 Cilium and associated proteins [BR:carb03037]  Motile cilia and associated proteins   Dynein arm    113688431 Cytoskeleton proteins [BR:carb04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      113688431 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  113688431 NCBI-ProteinID:  XP_027062044 UniProt:  A0A6P6S8A2 LinkDB All DBs Position 5e:complement(52042452..52043443) Genome browser AA seq 109 aa AA seqDB search MLEGKAVIGETDMLETMQQDALDLAAKALDFFDVTEATEIACFIKKAFDRTHGPGWQCIV GTDFGSFVTHCCGCFIYFCIGSLAILLFRGSAVPEAEPGQRVAPLEEVA NT seq 330 nt NT seq  +upstreamnt  +downstreamnt atgttagaaggaaaagcagtaatcggggaaactgatatgcttgagaccatgcaacaagat gcacttgatttggcagccaaggcacttgacttctttgatgtcactgaagccactgaaata gcctgcttcattaagaaggcatttgataggacgcacggaccagggtggcaatgcatcgtg ggaactgattttggttcattcgtgactcattgctgcggctgtttcatctacttttgcata ggcagccttgcaattttgctattcaggggctcagctgttccagaagctgagccaggtcaa cgtgttgcacctttggaggaagtagcatga

DBGET integrated database retrieval system