Coffea arabica (coffee): 113691791 Help Entry 113691791         CDS       T11342                                  Name (RefSeq) uncharacterized protein   KO K03873   elongin-B Organism carb  Coffea arabica (coffee) Pathway carb04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:carb00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     113691791  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:carb04121]     113691791    03400 DNA repair and recombination proteins [BR:carb03400]     113691791 Ubiquitin system [BR:carb04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      113691791    Cul5 complex      113691791 DNA repair and recombination proteins [BR:carb03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      113691791 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin UBL_UBAC1 Rad60-SLD FlaG Chal_sti_synt_N Motif Other DBs NCBI-GeneID:  113691791 NCBI-ProteinID:  XP_027065889 UniProt:  A0A6P6SJ65 LinkDB All DBs Position 6c:13722964..13726590 Genome browser AA seq 118 aa AA seqDB search MSQQPSQTKSPADENHSEMYIRVKRSKTTYFLQCLPSEKVLQIKEKLQILIDQPVNDQRL ILLPNKEVLDDSKSLADQKVENDAVVALTLRKDDNEFEDVNIARPTDYYRDGDGGSNW NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atgtcccagcagccatcccagaccaagagcccagcagatgaaaatcactcggagatgtac attcgagttaagcgcagcaagaccacttacttcttgcaatgccttcccagtgaaaaagtt ttacagatcaaagagaagttgcagatcctaattgatcaaccagttaatgaccagcgattg attctgttgccaaataaagaagtacttgatgattcaaagtcattagctgatcagaaggtt gaaaatgatgcagttgtggcactaaccttgagaaaagatgacaatgaatttgaggatgtg aatatcgcgaggcctactgattactaccgtgatggtgatggtggctcaaattggtga

DBGET integrated database retrieval system