KEGG   Coffea arabica (coffee): 113710248
Entry
113710248         CDS       T11342                                 
Name
(RefSeq) SKP1-like protein 1A
  KO
K03094  S-phase kinase-associated protein 1
Organism
carb  Coffea arabica (coffee)
Pathway
carb03083  Polycomb repressive complex
carb04120  Ubiquitin mediated proteolysis
carb04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:carb00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    113710248
   04120 Ubiquitin mediated proteolysis
    113710248
  09126 Chromosome
   03083 Polycomb repressive complex
    113710248
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:carb04131]
    113710248
   04121 Ubiquitin system [BR:carb04121]
    113710248
   03036 Chromosome and associated proteins [BR:carb03036]
    113710248
Membrane trafficking [BR:carb04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    113710248
Ubiquitin system [BR:carb04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     113710248
   Cul7 complex
     113710248
Chromosome and associated proteins [BR:carb03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     113710248
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     113710248
SSDB
Other DBs
NCBI-GeneID: 113710248
NCBI-ProteinID: XP_027088952
UniProt: A0A6P6UGF5
LinkDB
Position
9e:40482741..40484514
AA seq 157 aa
MSSPKIIVLKSSDGETFEVEELVALESQTIKHMIEDNCADTCIPLPNVTSKILAKVIEYC
KKHVEAPKSSDGDKSSDEDLKSFDADFVKVDQGTLFDLILAANYLNIKSLLDLTCQTVAD
MIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENAWAFE
NT seq 474 nt   +upstreamnt  +downstreamnt
atgtcttcgccgaagataatcgtgttgaagagttctgacggcgaaactttcgaggtggag
gaattggtcgctctggaatcgcagaccatcaagcacatgatcgaggacaactgcgccgat
acttgcatccctctgcccaacgtcaccagcaagatcttggctaaggtcatcgagtactgt
aagaaacatgtcgaggccccgaagtcctccgacggcgacaagtcctccgatgaggatctc
aagtccttcgatgctgacttcgtcaaagtcgaccagggcactcttttcgacctcatcctg
gctgccaactatctcaacatcaagagcctgctcgacctcacttgccaaactgtggcagac
atgatcaagggcaagacgccagaggagatccgcaagactttcaacatcaagaatgatttc
actcctgaggaagaagaggaggttcgcagggagaatgcttgggcatttgagtga

DBGET integrated database retrieval system