Coffea arabica (coffee): 113715625 Help Entry 113715625         CDS       T11342                                  Name (RefSeq) uncharacterized protein   KO K03505   DNA polymerase delta subunit 4 Organism carb  Coffea arabica (coffee) Pathway carb03030   DNA replication carb03410   Base excision repair carb03420   Nucleotide excision repair carb03430   Mismatch repair carb03440   Homologous recombination Brite KEGG Orthology (KO) [BR:carb00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     113715625    03410 Base excision repair     113715625    03420 Nucleotide excision repair     113715625    03430 Mismatch repair     113715625    03440 Homologous recombination     113715625  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:carb03032]     113715625    03400 DNA repair and recombination proteins [BR:carb03400]     113715625 DNA replication proteins [BR:carb03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     113715625 DNA repair and recombination proteins [BR:carb03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       113715625    MMR (mismatch excision repair)     DNA polymerase delta complex      113715625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  113715625 NCBI-ProteinID:  XP_027095677 UniProt:  A0A6P6UY01 LinkDB All DBs Position 11c:9812420..9815061 Genome browser AA seq 126 aa AA seqDB search MATSKSDMKGFFKQKKKSGGITKAKAKSSSTKKSLSPKRSATYGSDITQPAALISHGSPD IEDDYDEKEEVLRQFDMNMAYGPCLGMSRLARWERAKSLGMNPPEDIGHLLKAGKVGAEC LWEGRV NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atggcaacatcaaaatcagatatgaagggcttcttcaagcaaaagaagaagtctggtggc ataacaaaggcgaaggccaaatcatcatctacaaagaaatctctgtctccaaagcgctca gctacttatggctctgacatcactcaacctgctgctcttatctcacatggttctcctgac attgaagatgattatgatgaaaaagaggaggttctcaggcaatttgacatgaacatggca tacggaccatgccttgggatgagcaggcttgctcgctgggagcgtgccaaatccttgggc atgaatcctcctgaagatatagggcatctcttgaaagctggcaaagttggagctgaatgt ttgtgggaagggcgtgtttag

DBGET integrated database retrieval system