Collimonas arenae: LT85_1070
Help
Entry
LT85_1070 CDS
T03512
Name
(GenBank) Transcriptional regulator
Organism
care
Collimonas arenae
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
LysR_substrate
HTH_1
Motif
Other DBs
NCBI-ProteinID:
AIY40228
UniProt:
A0A0A1F6B5
LinkDB
All DBs
Position
complement(1207761..1208654)
Genome browser
AA seq
297 aa
AA seq
DB search
MHIELRQLRYFVAVAEERHFGRAALRLHMTQPPLSQAIQALEANLGATLFARTKRSVALT
PAGLALLPEAQRLLQQAATLPDLVRRAASGESGLLTLSFVSTADYSILPPLLRAFREAYP
LVQIDLQEATSDLQLAQLMEGRIDAGLLIPPLPDKARLVLDYQPVLAEPLILAAPSGLKA
LRGKGKIALSTLAEMPLIIFPRRISPGFHDTILGCFRAAGVTPHIGQEAIQMQTIVGLVS
AGMGIALVPQSVSNLQRPGVDYRELQDQTPLVETGLAWRRDNASPVLQAFLELLRKK
NT seq
894 nt
NT seq
+upstream
nt +downstream
nt
atgcacatagagttgcgacaactgcgctatttcgtggcggtggcggaagaacggcatttc
ggccgcgccgcactgcggctgcacatgacgcaaccgcctttgtcgcaggcgatccaggcg
ctcgaggccaaccttggcgccacactgtttgcgcgcaccaagcgcagcgtcgccctgact
ccggcaggactggcgttgttgccggaagcgcaacgcttgctgcagcaagccgccaccctg
cccgatctagtgcgacgtgcagcctccggcgaatccggactacttaccctgtcgtttgtc
tcaaccgccgattacagcatcctgccgcctttactgcgcgctttccgcgaagcctatccg
ctggtgcaaatcgacctgcaggaagccaccagcgacctgcaactggcgcaactgatggaa
ggcaggatcgacgccggcctgctgattccaccgctgccggacaaagcccggctggtgctt
gattaccagccggtgctcgccgagccgctgatcctggctgcgcctagcggcctcaaggcc
ttgcgcggcaaaggcaagatcgccctgagcacgctggctgagatgccgctgattattttc
ccgcgccgcatctcgcccggcttccacgacaccatcctgggctgtttccgcgctgcgggc
gtcaccccgcatatcggccaggaagccatccagatgcaaaccatcgtcggcttggtctcg
gctggcatggggatcgcgcttgtgccacaatcggtatcgaacctgcaacgccccggggtc
gactatcgcgaattgcaggaccagacgcccttggtcgaaactgggctggcctggcgccgc
gataatgcctcacctgtattgcaagcctttttggaattgttgagaaagaaataa
DBGET
integrated database retrieval system