Collimonas arenae: LT85_2347 Help Entry LT85_2347         CDS       T03512                                  Name (GenBank) hypothetical protein   KO K03746   DNA-binding protein H-NS Organism care  Collimonas arenae Brite KEGG Orthology (KO) [BR:care00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:care03036]     LT85_2347    03400 DNA repair and recombination proteins [BR:care03400]     LT85_2347 Chromosome and associated proteins [BR:care03036]  Prokaryotic type   Nucleoid associated proteins    HNS (histone-like nucleoid structuring protein)     LT85_2347 DNA repair and recombination proteins [BR:care03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHDIR (short-homology-dependent illegitimate recombination)      Supressor       LT85_2347 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HalX DUF6381 DUF7307 Motif Other DBs NCBI-ProteinID:  AIY41505 UniProt:  A0A0A1FCJ9 LinkDB All DBs Position complement(2628612..2628860) Genome browser AA seq 82 aa AA seqDB search MTTYKELQAQIEQLRKQAEELRQAEIADVIIEIKTKMQEYGITGADLGLMGKKRIMKTSP AMEAETPAMTPVVEDASAGGEM NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacgacctacaaagagctgcaagcacaaatcgaacaattgaggaaacaggcagaagaa ttgcgtcaagctgagattgctgacgtcatcatcgagattaaaacaaaaatgcaggaatac ggcattaccggagcggacctgggtctcatgggcaagaaacgcatcatgaaaacctcgccg gcgatggaagcagaaacgccggcgatgacacctgtcgttgaagatgcgtcggctggcggc gaaatgtaa

DBGET integrated database retrieval system