Chryseobacterium arthrosphaerae: EGY05_16945 Help Entry EGY05_16945       CDS       T05746                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism carh  Chryseobacterium arthrosphaerae Brite KEGG Orthology (KO) [BR:carh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:carh03032]     EGY05_16945    03036 Chromosome and associated proteins [BR:carh03036]     EGY05_16945    03400 DNA repair and recombination proteins [BR:carh03400]     EGY05_16945 DNA replication proteins [BR:carh03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     EGY05_16945 Chromosome and associated proteins [BR:carh03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     EGY05_16945 DNA repair and recombination proteins [BR:carh03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       EGY05_16945 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AYZ13521 UniProt:  A0A1B8ZU28 LinkDB All DBs Position 3667683..3667973 Genome browser AA seq 96 aa AA seqDB search MNKSELIDAIAKDAGITKVAAKAALESFIGNVTSTLKKKDGKVSLVGFGTFSVAERAARQ GINPATKKPIKIAAKKVAKFKAGADLSNAVSGAKKK NT seq 291 nt NT seq  +upstreamnt  +downstreamnt atgaacaagtctgaattaatcgacgcaatcgcaaaagatgcaggtatcactaaagttgca gcaaaagctgctttagagtctttcattggtaacgtaacttctactttaaagaaaaaagac ggaaaagtttctttagtaggtttcggtactttctcagtagctgagagagcagccagacaa ggtattaaccctgcaactaagaaaccaatcaaaattgctgctaaaaaagttgctaaattc aaagctggagctgatttatcaaatgcagtttccggtgctaagaaaaaataa

DBGET integrated database retrieval system