Caproicibacterium argilliputei: PXC00_01520 Help Entry PXC00_01520       CDS       T09713                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism carl  Caproicibacterium argilliputei Pathway carl01100   Metabolic pathways carl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:carl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     PXC00_01520 (acpP)    00074 Mycolic acid biosynthesis     PXC00_01520 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     PXC00_01520 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 Ribosomal_L50 DUF1493 Motif Other DBs NCBI-ProteinID:  WOC32576 UniProt:  A0AA97D984 LinkDB All DBs Position 334826..335053 Genome browser AA seq 75 aa AA seqDB search MVLEKVKHILAEQFDVEEENINAETSIADDLGADSLDVVDLLMSIEDEFEIEVPDGEIDN IKTVGDLVNYIEEHM NT seq 228 nt NT seq  +upstreamnt  +downstreamnt gtggtactggaaaaagtcaagcacattctcgccgaacagtttgatgtggaggaagaaaac atcaacgcagagacgagcattgccgacgatctgggcgccgattcactggatgtggtggat ttgctgatgtctattgaggacgaatttgaaattgaagtcccggatggagagattgacaac atcaaaaccgttggggatcttgtcaattatattgaagagcatatgtaa

DBGET integrated database retrieval system