Clostridium asparagiforme: NQ535_19210
Help
Entry
NQ535_19210 CDS
T08571
Name
(GenBank) ATP-dependent helicase
KO
K03657
ATP-dependent DNA helicase UvrD/PcrA [EC:
5.6.2.4
]
Organism
casp
Clostridium asparagiforme
Pathway
casp03420
Nucleotide excision repair
casp03430
Mismatch repair
Brite
KEGG Orthology (KO) [BR:
casp00001
]
09120 Genetic Information Processing
09124 Replication and repair
03420 Nucleotide excision repair
NQ535_19210
03430 Mismatch repair
NQ535_19210
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03400 DNA repair and recombination proteins [BR:
casp03400
]
NQ535_19210
Enzymes [BR:
casp01000
]
5. Isomerases
5.6 Isomerases altering macromolecular conformation
5.6.2 Enzymes altering nucleic acid conformation
5.6.2.4 DNA 3'-5' helicase
NQ535_19210
DNA repair and recombination proteins [BR:
casp03400
]
Prokaryotic type
SSBR (single strand breaks repair)
NER (nucleotide excision repair)
GGR (global genome repair) factors
NQ535_19210
MMR (mismatch excision repair)
Other MMR factors
NQ535_19210
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UvrD-helicase
UvrD_C
AAA_19
UvrD_C_2
Viral_helicase1
AAA_30
AAA_22
AAA_12
AAA_11
ResIII
AAA_16
DEAD
GapR_DNA-bd
Motif
Other DBs
NCBI-ProteinID:
UWO74952
LinkDB
All DBs
Position
complement(4228104..4229933)
Genome browser
AA seq
609 aa
AA seq
DB search
MAFNEAQLKAIRHGDGPALILAGPGSGKTTVITNRIRFLTEEEGVNPSSILVITFTRAAA
TEMQKRYEQMTQTGCAKPAFGTFHSVFFMILKLAYRYDAGSIVREEQRVEFLRELLRRYE
IETEDESEFISGVLSEISMVKGEMIGVEHYYAKSCSADVFRRLYKGYEAALRGAGLLDFD
DMLVMCRELFDQRADILQAWQRKYRYILIDEFQDINRIQYEVIRMMALPENNLFIVGDDD
QSIYRFRGARPEIMLGFEKDYPGTEKILLDQNYRSTEQIIGAAGRLIDHNKTRFSKDITA
VRGPGRSVVAKEFADPGAEARAIAAQLRDYVRLGVPYEDIAVLYRTNIGPRRLVEVLMEY
NIPFHMRDKLPNLYEHWIARDILAYLRAAAGDMSRANLLRIVNRPIRYISRDALDGKTIS
LEAVKSFYQDREWMVERVEQLEYDLKNIRTLPPGKAVNYIRKAVGYDDYLREYAGERQLD
PEELREVLDQLQESAMPHASLEEWETYMENYRRKLEEQAASRQLRQEGVHLMTMHSSKGL
EFRVVFILDANEGVTPHHKAALDADLEEERRMFYVAMTRAKDRLHVYYVKERYHKKQTVS
RFVEEAEII
NT seq
1830 nt
NT seq
+upstream
nt +downstream
nt
atggcgtttaatgaagcccagttaaaagcgatccggcatggggacggcccggctctgatt
ctggctggccccggttccggaaaaaccacggtgattaccaaccgcatccgttttctgact
gaggaggagggcgtaaacccctcctccattctggtgattacctttacccgggccgcggcc
acggagatgcagaaacgctatgaacagatgacgcagacaggatgtgcaaagcccgccttc
gggaccttccattctgtcttttttatgatactcaaactggcctaccgctacgatgcgggc
agcattgtgcgggaggagcagcgggtggaatttctgcgggagctgttaaggcggtacgag
atcgagacggaggacgagagcgagtttatctccggcgtgctcagtgagatcagcatggtc
aaaggggagatgatcggcgtggagcactactacgccaagagctgctccgccgacgtgttc
cggcggctttacaagggttatgaggcggccctgcggggagcgggacttctggatttcgac
gacatgctggtgatgtgccgggaactgtttgaccagcgggcggatattttgcaggcatgg
cagaggaaataccggtacatactaatcgatgagttccaggacatcaaccgcatccagtac
gaggtgatccgtatgatggccctgccggagaacaacctgtttatcgtgggcgacgacgac
cagtccatttaccggttccggggagccaggccggagatcatgctgggatttgagaaggac
tacccgggaaccgagaagattcttctggatcagaattaccgctctaccgaacagatcatc
ggggcggccggccggctgatcgaccacaacaaaacccgtttttccaaggacatcacggcg
gtccgggggccggggcgctccgtggtggcaaaggagttcgccgatccgggagcggaggcc
agggccatcgccgcccagctgcgggattacgtgcggttgggagtgccctacgaggatata
gccgtgctgtaccgcaccaacatcggtccccgccgtctggtggaggtgctgatggagtat
aatattcccttccacatgcgggacaaattgccgaatctctacgagcactggatcgccaga
gatatcctggcctatctgcgggctgcggcgggggacatgagccgggcaaacctgctgcgg
atcgtcaaccggcccatccggtacatcagccgggacgctctggacggaaagaccatctcc
ctggaggcggtgaaatccttttaccaggaccgggagtggatggtggagcgtgtggagcag
ttggagtacgatctgaaaaatatccgcaccctaccccctggcaaggcggtgaactatatc
cgcaaggcggtgggctacgatgattatctgcgggaatacgcgggggagcgccagctggac
cctgaggagctgcgggaggtattggaccagctccaggagagcgccatgcctcacgcctct
ttggaggagtgggagacgtacatggagaactacaggcggaaattggaggagcaggcggcg
tcccggcagctccggcaggagggcgtgcatctcatgaccatgcacagctccaaggggctg
gagttccgggtggtgttcattttggacgccaacgagggcgtgacgccccatcacaaggct
gcgctggacgcggacctggaggaggaacgccggatgttctacgtggccatgaccagggcc
aaggaccggcttcatgtctattatgtgaaagagcggtatcacaagaaacagacggtatcg
cgttttgtggaggaggcggagattatttga
DBGET
integrated database retrieval system