Cygnus atratus (black swan): 118243319 Help Entry 118243319         CDS       T09349                                  Symbol ELOB Name (RefSeq) elongin-B   KO K03873   elongin-B Organism cata  Cygnus atratus (black swan) Pathway cata04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:cata00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     118243319 (ELOB)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:cata04121]     118243319 (ELOB)    03400 DNA repair and recombination proteins [BR:cata03400]     118243319 (ELOB) Ubiquitin system [BR:cata04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    Cul2 complex     Adoptor protein      118243319 (ELOB)    Cul5 complex      118243319 (ELOB) DNA repair and recombination proteins [BR:cata03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      118243319 (ELOB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  118243319 NCBI-ProteinID:  XP_035393206 LinkDB All DBs Position 7:19728450..19728815 Genome browser AA seq 121 aa AA seqDB search MDVYLMIRRHKMTIFTEAKETTTVHELKKVVEGILKRPPEEQRLYKDDQLLDDDDRTLLD CGLSSQNCRPHIPATVGLALFRPGSGSFEPLRIDPFSSTPELPDVVKSQDSGSSSSEQAL R NT seq 366 nt NT seq  +upstreamnt  +downstreamnt atggatgtctacctgatgattcgacgtcacaagatgacaatcttcactgaggccaaagag acaacaactgtgcatgagttgaaaaaggtggtggagggaatactgaagaggccaccggag gagcagaggctctacaaagatgaccagctgctggatgatgatgacagaactttgctagac tgtggcttaagcagccaaaactgccgtcctcatattcctgccacagtgggcttagcttta ttcagacctggtagtggctcctttgagccactgcgcattgaccccttctcaagcacccca gagctacctgatgttgtgaagtcacaagactctggtagcagctccagtgagcaagccttg cgttaa

DBGET integrated database retrieval system