Cygnus atratus (black swan): 118243832 Help Entry 118243832         CDS       T09349                                  Symbol DYNLT1 Name (RefSeq) dynein light chain Tctex-type 1   KO K10420   dynein light chain Tctex-type 1/3 Organism cata  Cygnus atratus (black swan) Pathway cata04814   Motor proteins cata05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cata00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     118243832 (DYNLT1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118243832 (DYNLT1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cata03037]     118243832 (DYNLT1)    04812 Cytoskeleton proteins [BR:cata04812]     118243832 (DYNLT1) Cilium and associated proteins [BR:cata03037]  Motile cilia and associated proteins   Dynein arm    118243832 (DYNLT1) Cytoskeleton proteins [BR:cata04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      118243832 (DYNLT1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  118243832 NCBI-ProteinID:  XP_035394186 LinkDB All DBs Position 3:64724351..64729136 Genome browser AA seq 113 aa AA seqDB search MDDFQAGDETSFVVDEVSNIIKEAIESAIGGNAYQHSKVNQWTTSVVEQTLSQLTKLGKP FKYIVTCVIMQKNGAGLHTASSCFWDNSSDGTCTVRWENKTMYCIVSAFGLAI NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggacgacttccaggcgggggacgagacttcctttgtcgttgatgaagtcagtaacatc attaaagaggccatagaaagtgcgatcggtggcaatgcctaccagcacagcaaagtgaac cagtggacaacaagtgtggtggaacaaactctaagccagctcacaaagctggggaaaccc ttcaagtatattgtgacctgtgtgattatgcaaaagaatggtgctgggctacatacagcg agctcttgcttctgggacaactccagtgatggaacttgtactgtgagatgggagaataag accatgtactgtattgtcagtgcctttggacttgcaatataa

DBGET integrated database retrieval system