Cygnus atratus (black swan): 118244761 Help Entry 118244761         CDS       T09349                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism cata  Cygnus atratus (black swan) Pathway cata04010   MAPK signaling pathway cata04068   FoxO signaling pathway cata04081   Hormone signaling cata04114   Oocyte meiosis cata04140   Autophagy - animal cata04150   mTOR signaling pathway cata04810   Regulation of actin cytoskeleton cata04910   Insulin signaling pathway cata04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:cata00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118244761 (INS)    04068 FoxO signaling pathway     118244761 (INS)    04150 mTOR signaling pathway     118244761 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     118244761 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118244761 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     118244761 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118244761 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     118244761 (INS)    04914 Progesterone-mediated oocyte maturation     118244761 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:cata04052]     118244761 (INS) Cytokines and neuropeptides [BR:cata04052]  Neuropeptides   Unclassified    118244761 (INS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  118244761 NCBI-ProteinID:  XP_035395820 LinkDB All DBs Position 5:37385417..37388839 Genome browser AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSGPGISHAAANQHLCGSHLVEALYLVCGERGFFYSPKTRRDVEQ PLVSGPLHGEVGELPFQHEEYQKVKRGIVEQCCENPCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccggtcgctgcctctcctggcccttcttgctctttctggccctggg atcagccacgcggctgccaaccagcacctctgtggctcccacttggttgaggctctctac ctggtgtgtggagagcggggtttcttctactcccccaaaacccgacgggacgttgagcag cctctagtgagtggtcccttgcatggtgaggtgggagagctgccgttccaacatgaggaa taccagaaagtcaagcgaggcatcgttgagcaatgctgcgaaaacccatgctccctctac caactggaaaactactgcaactag

DBGET integrated database retrieval system