Cygnus atratus (black swan): 118248139 Help Entry 118248139         CDS       T09349                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism cata  Cygnus atratus (black swan) Pathway cata04137   Mitophagy - animal cata04140   Autophagy - animal cata04144   Endocytosis cata04145   Phagosome cata04148   Efferocytosis cata05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cata00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     118248139 (RAB7A)    04145 Phagosome     118248139 (RAB7A)    04140 Autophagy - animal     118248139 (RAB7A)    04137 Mitophagy - animal     118248139 (RAB7A)    04148 Efferocytosis     118248139 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118248139 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cata04131]     118248139 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cata04147]     118248139 (RAB7A)    04031 GTP-binding proteins [BR:cata04031]     118248139 (RAB7A) Membrane trafficking [BR:cata04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     118248139 (RAB7A) Exosome [BR:cata04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118248139 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    118248139 (RAB7A)   Exosomal proteins of colorectal cancer cells    118248139 (RAB7A)   Exosomal proteins of bladder cancer cells    118248139 (RAB7A) GTP-binding proteins [BR:cata04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     118248139 (RAB7A) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_24 AAA_16 G-alpha AAA_5 ATPase_2 AAA_14 NACHT NB-ARC ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  118248139 NCBI-ProteinID:  XP_035402704 LinkDB All DBs Position 10:12339471..12369794 Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRVKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacttctaggaagaaagtgttactgaaagtcatcatccttggagactccggggtggga aagacatcgctcatgaaccagtatgtgaacaagaaattcagtaaccagtacaaggctacg ataggtgcagacttcctgacaaaagaagtcatggtggatgacaggctagtgacaatgcag atatgggatacagcaggacaagaacggtttcagtctctgggagttgccttctacagggga gcagactgctgtgtgctggtgttcgatgtcacggcccctaacacattcaaaaccctagac agctggagggatgaattcctcattcaggccagtccaagggatcctgagaactttcctttt gttgtgctgggaaacaagattgacctagaaaacagacaagtcaccacaaaacgggcgcaa gcctggtgctacagtaaaaacaacatcccctactttgaaaccagtgccaaggaggccatt aatgtggaacaagctttccagacgattgcacgaaatgcacttaaacaggaaaccgaagtg gagctttacaatgaattccccgaacccatcaaactagacaagaatgaccgagtgaaggct tctgcggagagctgcagctgctga

DBGET integrated database retrieval system