Cygnus atratus (black swan): 118250537 Help Entry 118250537         CDS       T09349                                  Symbol CBY1 Name (RefSeq) protein chibby homolog 1   KO K23402   protein chibby 1 Organism cata  Cygnus atratus (black swan) Pathway cata04310   Wnt signaling pathway Brite KEGG Orthology (KO) [BR:cata00001]  09130 Environmental Information Processing   09132 Signal transduction    04310 Wnt signaling pathway     118250537 (CBY1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:cata03037]     118250537 (CBY1) Cilium and associated proteins [BR:cata03037]  Primary cilia and associated proteins   Other primary cilia associated proteins    118250537 (CBY1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Chibby Taxilin LapA_dom Motif Other DBs NCBI-GeneID:  118250537 NCBI-ProteinID:  XP_035407657 LinkDB All DBs Position 1:complement(54712604..54715657) Genome browser AA seq 126 aa AA seqDB search MPLFGNTFSPKKTPPRKAASLSNLHLLDRSTREIELGLEYGSPTMNLAGQSLKFENGQWV AESGSFTGDRREMQRLRKRNQQLEEENNLLRLKVDILLDMLSETTAESHLMEKELEELKT HSRRRK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctctcttcggtaacaccttcagccccaagaaaacgccgccgcggaaagccgcctcg ctctccaatttgcacttgctggatagatccacccgtgagattgagctgggcctggagtat ggcagccccaccatgaaccttgctggccagagcctgaagtttgaaaatggccagtgggtg gcagagtcagggagcttcacgggagatcgcagggaaatgcagcgcttgcgcaaacgaaac cagcagctggaggaggagaacaacctgcttcgcttgaaagtggatattttgctggacatg ctctccgagaccacggccgagtcccacctgatggagaaggagctggaggagctgaagact cacagccggaggaggaagtga

DBGET integrated database retrieval system