Cygnus atratus (black swan): 118251786 Help Entry 118251786         CDS       T09349                                  Symbol RHEB Name (RefSeq) GTP-binding protein Rheb   KO K07208   Ras homolog enriched in brain Organism cata  Cygnus atratus (black swan) Pathway cata04140   Autophagy - animal cata04150   mTOR signaling pathway cata04218   Cellular senescence cata04910   Insulin signaling pathway cata05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:cata00001]  09130 Environmental Information Processing   09132 Signal transduction    04150 mTOR signaling pathway     118251786 (RHEB)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118251786 (RHEB)   09143 Cell growth and death    04218 Cellular senescence     118251786 (RHEB)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     118251786 (RHEB)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     118251786 (RHEB)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:cata04031]     118251786 (RHEB) GTP-binding proteins [BR:cata04031]  Small (monomeric) G-proteins   Ras Family    Rheb     118251786 (RHEB) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase SRPRB AAA_14 RhoGAP_pG1_pG2 Motif Other DBs NCBI-GeneID:  118251786 NCBI-ProteinID:  XP_035410253 LinkDB All DBs Position 2:complement(6859859..6900665) Genome browser AA seq 184 aa AA seqDB search MPPSKSRKIAILGYRSVGKSSLTIQFVEGQFVDSYDPTIENTFTKLITVNGQEYHLQLVD TAGQDEYSIFPQTYSIDINGYILVYSVTSIKSFEVIKVIHGKLLDMVGKVQIPIMLVGNK KDLHMERVISYEEGKALAESWNAAFLESSAKENQTAVDVFKRIILEAEKIDGAASQGKSS CSVM NT seq 555 nt NT seq  +upstreamnt  +downstreamnt atgccgccgtccaagtcccgcaagatcgcgatcctgggctaccggagcgtgggaaaatct tcactgacgattcagtttgtggaagggcagttcgttgattcatatgatccaaccatagag aacacttttacaaaattgatcacagtaaatggccaagaatatcatcttcagctggttgac actgctggccaagatgaatactccatatttcctcagacgtactccatagacatcaatggc tacattcttgtttattcagtcacgtcaataaaaagttttgaagtgataaaagttatccat ggcaagttattggatatggtgggaaaagtccaaatacccattatgctggttggaaataaa aaagacctgcatatggaacgggtgatcagctatgaagaagggaaagctttagcagaatcc tggaatgcagctttcttggaatcttctgctaaagaaaatcagactgccgttgatgttttt aagaggataattttggaggcagaaaaaattgatggggcagcttcacaagggaagtcttca tgctcagtaatgtaa

DBGET integrated database retrieval system