Cygnus atratus (black swan): 118255298 Help Entry 118255298         CDS       T09349                                  Symbol NRAS Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism cata  Cygnus atratus (black swan) Pathway cata04010   MAPK signaling pathway cata04012   ErbB signaling pathway cata04068   FoxO signaling pathway cata04137   Mitophagy - animal cata04140   Autophagy - animal cata04150   mTOR signaling pathway cata04210   Apoptosis cata04218   Cellular senescence cata04370   VEGF signaling pathway cata04371   Apelin signaling pathway cata04540   Gap junction cata04625   C-type lectin receptor signaling pathway cata04810   Regulation of actin cytoskeleton cata04910   Insulin signaling pathway cata04912   GnRH signaling pathway cata04916   Melanogenesis Brite KEGG Orthology (KO) [BR:cata00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     118255298 (NRAS)    04012 ErbB signaling pathway     118255298 (NRAS)    04370 VEGF signaling pathway     118255298 (NRAS)    04371 Apelin signaling pathway     118255298 (NRAS)    04068 FoxO signaling pathway     118255298 (NRAS)    04150 mTOR signaling pathway     118255298 (NRAS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     118255298 (NRAS)    04137 Mitophagy - animal     118255298 (NRAS)   09143 Cell growth and death    04210 Apoptosis     118255298 (NRAS)    04218 Cellular senescence     118255298 (NRAS)   09144 Cellular community - eukaryotes    04540 Gap junction     118255298 (NRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     118255298 (NRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     118255298 (NRAS)   09152 Endocrine system    04910 Insulin signaling pathway     118255298 (NRAS)    04912 GnRH signaling pathway     118255298 (NRAS)    04916 Melanogenesis     118255298 (NRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cata04131]     118255298 (NRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:cata04147]     118255298 (NRAS)    04031 GTP-binding proteins [BR:cata04031]     118255298 (NRAS) Membrane trafficking [BR:cata04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     118255298 (NRAS)  Endocytosis   Macropinocytosis    Ras GTPases     118255298 (NRAS) Exosome [BR:cata04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    118255298 (NRAS)   Exosomal proteins of other body fluids (saliva and urine)    118255298 (NRAS)   Exosomal proteins of breast cancer cells    118255298 (NRAS)   Exosomal proteins of colorectal cancer cells    118255298 (NRAS) GTP-binding proteins [BR:cata04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     118255298 (NRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 FeoB_N Septin Ldh_1_N ParA Motif Other DBs NCBI-GeneID:  118255298 NCBI-ProteinID:  XP_035417274 LinkDB All DBs Position 24:245299..254143 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL PTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSEDGNQG CMGLSCIVM NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaagctagtggtggtgggagccggcggcgtcggcaagagcgcgctgacc atccagctcatccagaaccacttcgtggacgagtacgaccccaccatcgaggactcatac agaaagcaggttgttattgatggagagacatgcttgttagatattctggacactgcagga caggaagaatatagtgctatgcgcgatcagtacatgagaactggggaaggattcctctgc gtgtttgccattaacaacagtaaatcatttgctgatattaacctttacagagagcaaatc aagagagtgaaagattcagatgatgtgccaatggttctggttgggaataagtgtgatttg cccacaagaacagtagacacaaaacaggcccaagaattagcaaaaagctatggaatcccc tttatagagacatctgctaaaacaagacagggtgttgaagatgctttttacacgctggtg agagagatccggcagtaccggatgaaaaagctcaacagcagtgaagatgggaatcaaggc tgcatgggattgtcctgcattgtgatgtga

DBGET integrated database retrieval system