Cygnus atratus (black swan): 118256951
Help
Entry
118256951 CDS
T09349
Symbol
GADD45A
Name
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha
KO
K04402
growth arrest and DNA-damage-inducible protein
Organism
cata
Cygnus atratus (black swan)
Pathway
cata04010
MAPK signaling pathway
cata04068
FoxO signaling pathway
cata04110
Cell cycle
cata04115
p53 signaling pathway
cata04210
Apoptosis
cata04218
Cellular senescence
Brite
KEGG Orthology (KO) [BR:
cata00001
]
09130 Environmental Information Processing
09132 Signal transduction
04010 MAPK signaling pathway
118256951 (GADD45A)
04068 FoxO signaling pathway
118256951 (GADD45A)
09140 Cellular Processes
09143 Cell growth and death
04110 Cell cycle
118256951 (GADD45A)
04210 Apoptosis
118256951 (GADD45A)
04115 p53 signaling pathway
118256951 (GADD45A)
04218 Cellular senescence
118256951 (GADD45A)
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03036 Chromosome and associated proteins [BR:
cata03036
]
118256951 (GADD45A)
Chromosome and associated proteins [BR:
cata03036
]
Eukaryotic type
Centrosome formation proteins
Centrosome duplication proteins
Other centrosome duplication proteins
118256951 (GADD45A)
Sister chromatid separation proteins
Aurora kinases
Regulators of Aurora kinases
118256951 (GADD45A)
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Ribosomal_L7Ae
Motif
Other DBs
NCBI-GeneID:
118256951
NCBI-ProteinID:
XP_035420293
LinkDB
All DBs
Position
8:31386249..31387496
Genome browser
AA seq
157 aa
AA seq
DB search
MTLEELPGEHRTAGRMEQAGDALEEVLSKALSQRSLTLGVYEAAKLLNVDPDNVVLCLLA
ADEEEAGDAALQIHFTLIQAFCCENDINILRVSNPARLAQLLLPHTGAEPPTDLHCVLVT
NPHASQWKDPALSQLMCFCRERRYADQWVPVINLPER
NT seq
474 nt
NT seq
+upstream
nt +downstream
nt
atgactctggaggagctgcctggcgagcaccgcacggccggcaggatggagcaggcgggg
gacgcgctggaggaggtgctgagcaaggcgctgagccagcggagcctcaccctgggcgtc
tacgaggcggctaagctgctcaacgtggacccggacaacgtggtgctgtgcctgctggcg
gcggacgaggaagaagccggcgacgcggcgctgcagatccacttcaccctgatccaggct
ttctgctgcgagaacgacatcaacatcctgcgggtcagcaacccggcccgcctggctcag
ctcctgctgccccacaccggcgccgagccccccaccgacctccactgcgtcctggtcacg
aacccccacgcgtcccagtggaaggacccggcgctgagtcagctcatgtgcttctgccgg
gagcggcgctacgccgaccagtgggtgccggtcatcaacctccccgagcggtga
DBGET
integrated database retrieval system