KEGG   Cygnus atratus (black swan): 118257827
Entry
118257827         CDS       T09349                                 
Symbol
CDT1
Name
(RefSeq) DNA replication factor Cdt1
  KO
K10727  chromatin licensing and DNA replication factor 1
Organism
cata  Cygnus atratus (black swan)
Pathway
cata04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:cata00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    118257827 (CDT1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:cata03032]
    118257827 (CDT1)
   03036 Chromosome and associated proteins [BR:cata03036]
    118257827 (CDT1)
DNA replication proteins [BR:cata03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    118257827 (CDT1)
Chromosome and associated proteins [BR:cata03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     118257827 (CDT1)
SSDB
Motif
Pfam: CDT1 CDT1_C
Other DBs
NCBI-GeneID: 118257827
NCBI-ProteinID: XP_035422103
LinkDB
Position
12:complement(1725342..1729615)
AA seq 595 aa
MAQLRLTDFFGRAKAAAAVPTKRGGGPRLKAAPGGAPVHREAEDGAPPPPLPASPRTPSR
GAVPAVPGLAGRKRSRREMEAEPLTGAGTGERGGKSARKRLELPTDEGPPAAAASPPPAK
PPPAGRTRSPGREQDGGTVPRKALHLELEDLAALRNRLQRMKMKTPSQLLPIPAGAGAEL
RSRLETLRGLELRLRDKAAASGAQTQETTAPAAEATGGQKLPAYQRFHALAQDQPPGLTL
PYKYKVLAEMFRSVDTIAGMLFNRAETITFAKVKQGVQDMMRKQFEERHVGQIKAVYPTS
YRLRQEKNIPTFGSGVKKSDYQLTLEPVLGEDEKVCGRPHLSASRLLERRKEFNRSLVNI
VKQHHAAFLATLTPPMVVPEDKLTRWHPRFNVDEVPDISPAELPRPPQEDRITTAQELLS
TARGMMIPKMEKALANLALRTAEAGAGEPVLSKAPSPASTSSALKGVSQALLERIRAKEA
RKLQALMTRDPRQEERLAMLGRLPAMARVLRNVFVAEKKQALPLEVACARMAESFPTQMT
AGEMEKHLRLFAELLPDWVGIHAIRTDTYIKLDKNKDLGLIVERLAKAAKEAEAL
NT seq 1788 nt   +upstreamnt  +downstreamnt
atggctcagctccgcctcaccgacttcttcggccgtgccaaggcggccgccgccgtcccc
accaagcgcggcggcggcccccggctgaaggcagccccagggggagccccggtgcaccgg
gaggccgaggatggagccccgccaccgccgctgcccgcctcgccccgcaccccgtcccgc
ggcgctgtcccggccgtgccggggctggcgggcaggaagcggagccgccgcgagatggaa
gcggagccgctcaccggggccggtaccggggagcgcggagggaaatcggcgcggaagagg
ctggagctgcccacggacgaggggccgccggctgcggccgccagccccccaccggcaaag
ccccccccggcgggcaggacccgatctcctggccgggagcaggatggcgggaccgtgccg
cggaaagccctgcacctggagctggaggacctggccgcgctgcggaaccgcctgcagagg
atgaagatgaagaccccgtcccagctgctgcccatccccgccggggccggtgctgagctg
cggagccgcctggagaccctgcggggcctggagctgcggctccgtgacaaggcggcggcg
agcggagcacagacacaggagacaacagctccggcagcggaggcgactggcggccagaag
ctccccgcgtaccagcggttccacgcccttgcgcaggaccagccgccggggctcacgctg
ccctacaagtacaaggtgctggctgagatgttccgcagcgtggacaccatcgccgggatg
ctcttcaaccgcgccgagaccatcaccttcgccaaggtcaagcagggggtgcaggacatg
atgcgcaagcagtttgaggagcggcacgtgggccagatcaaggcggtgtaccccacctcg
taccggctgcgccaggagaagaacatccccaccttcggcagcggcgttaagaagtccgac
taccagctcacgctggagcccgtgctgggggaagacgagaaggtgtgcggccgcccgcac
ctgtcggcatcgcgcttgctggagcgcaggaaggagttcaaccgcagcctggtgaacatc
gtcaagcagcaccacgcggcgttcctggccaccctcacgccccccatggtggtacccgag
gacaagctgacccgctggcatccccgcttcaacgtggacgaggtgccggacatcagcccg
gcagagctgccgcggccgccgcaggaggacaggatcaccacggcccaggagctgctgagc
acggctcggggcatgatgatccccaagatggaaaaagctcttgccaacctggccctgaga
accgctgaagccggtgcgggggaaccggtgctttccaaagcaccgtcccctgccagcacc
tccagcgctctgaagggggtgtcccaggcgctgctcgagcggatccgcgcgaaggaggcg
cggaagctgcaggcgctgatgacccgggacccgcggcaggaggagcggctggccatgctg
gggcggctgccggccatggcccgcgtcctgcgcaacgtcttcgtggccgagaagaagcag
gcgctgcccctggaggtggcgtgcgcccgcatggccgagagcttccccacgcagatgacc
gcgggagagatggagaaacacctgcgcctcttcgcggagctgctgcccgactgggtgggg
atccacgccatcaggacggacacctacatcaagctggacaagaacaaggacctcgggctc
atcgtggagaggctcgccaaggcggccaaggaggcggaagcgctctga

DBGET integrated database retrieval system