Cygnus atratus (black swan): 118257979 Help Entry 118257979         CDS       T09349                                  Symbol PFN2 Name (RefSeq) profilin-2 isoform X1   KO K05759   profilin Organism cata  Cygnus atratus (black swan) Pathway cata04810   Regulation of actin cytoskeleton cata05132   Salmonella infection Brite KEGG Orthology (KO) [BR:cata00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     118257979 (PFN2)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     118257979 (PFN2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:cata04131]     118257979 (PFN2)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:cata04812]     118257979 (PFN2)    04147 Exosome [BR:cata04147]     118257979 (PFN2) Membrane trafficking [BR:cata04131]  Others   Actin-binding proteins    Others     118257979 (PFN2) Cytoskeleton proteins [BR:cata04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      118257979 (PFN2) Exosome [BR:cata04147]  Exosomal proteins   Proteins found in most exosomes    118257979 (PFN2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  118257979 NCBI-ProteinID:  XP_035422325 LinkDB All DBs Position 9:26461960..26467611 Genome browser AA seq 140 aa AA seqDB search MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGIFQSITPVEIDMIVGKDREGFF TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRALVIVMGKEGVH GGTLNKKAYELALYLRRSDV NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccggctggcagagctacgtggacaacctgatgtgcgatggctgctgccaggaggcc gccattgtggggtactgcgacgccaagtacgtctgggcagccacggccggcggcatcttc cagagcatcacgccagtagaaatagatatgattgtaggaaaagaccgagagggtttcttc accaacggtctgacccttggtgcaaagaagtgctctgtgatcagagatagcctgtatgtt gatggtgactgcacaatggacatcaggacaaagagtcaaggtggtgagccaacatacaac gttgctgtaggcagagctggccgagcattggttatagtcatgggaaaggaaggtgtccat ggagggacactcaacaagaaagcatatgaactggctttatacctgaggaggtctgacgtc taa

DBGET integrated database retrieval system