Cygnus atratus (black swan): 7996705 Help Entry 7996705           CDS       T09349                                  Symbol ND4L, KEH02_p04 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism cata  Cygnus atratus (black swan) Pathway cata00190   Oxidative phosphorylation cata01100   Metabolic pathways Module cata_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:cata00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     7996705 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:cata03029]     7996705 (ND4L) Enzymes [BR:cata01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      7996705 (ND4L) Mitochondrial biogenesis [BR:cata03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     7996705 (ND4L) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  7996705 NCBI-ProteinID:  YP_002971042 UniProt:  C5H9W7 LinkDB All DBs Position MT:13049..13345 Genome browser AA seq 98 aa AA seqDB search MSPLHLSFYSAFVFSGLGLAFHRTHLVSALLCLESMMLSMFVGLSMWSIETQTPSFTMVP ILMLTFSACEAGTGLAILVASTRTHGSDHLHNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtcacccctgcacctgagcttttactcggcctttgtttttagcggacttggactagcc ttccaccggacccacctagtatctgccctactatgccttgaaagcatgatactatcaata tttgtaggcctatcaatatgatctatcgaaacccaaaccccctcattcaccatggtgcca attctcatactaaccttctcagcatgtgaagcaggcacgggcctagccatcctagtagcc tccacgcgcactcacggctccgaccacctacataatctgaaccttctacaatgctaa

DBGET integrated database retrieval system