Catellatospora sp. IY07-71: CS0771_19160 Help Entry CS0771_19160      CDS       T07191                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism cati  Catellatospora sp. IY07-71 Pathway cati03430   Mismatch repair Brite KEGG Orthology (KO) [BR:cati00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     CS0771_19160  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:cati03400]     CS0771_19160 Enzymes [BR:cati01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      CS0771_19160 DNA repair and recombination proteins [BR:cati03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      CS0771_19160 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Spectrin_SYNE1 Motif Other DBs NCBI-ProteinID:  BCJ72372 UniProt:  A0A810NEZ1 LinkDB All DBs Position complement(2121855..2122052) Genome browser AA seq 65 aa AA seqDB search MPAKQPEALSYEQARAELAEVVQKLESGGGTLEESLALWERGEKLAQICQHWLDGAKAKL DAATP NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atgcccgccaagcagcccgaggccctctcctacgagcaggcccgcgccgaactagccgag gtggtccagaaactagaatccggcggcggcaccctcgaggaatccctcgccctctgggaa cgaggcgaaaaactagcccaaatctgccagcactggctcgacggcgccaaagccaaactc gacgccgccaccccctga

DBGET integrated database retrieval system