Corynebacterium atrinae: CATRI_03440 Help Entry CATRI_03440       CDS       T09346                                  Symbol mrx1 Name (GenBank) Mycoredoxin 1   KO K18917   mycoredoxin [EC:1.20.4.3] Organism catr  Corynebacterium atrinae Brite KEGG Orthology (KO) [BR:catr00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CATRI_03440 (mrx1) Enzymes [BR:catr01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CATRI_03440 (mrx1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin GST_N_2 Glrx-like Thioredoxin GST_N_3 AhpC-TSA Thioredoxin_2 Thioredoxin_9 Motif Other DBs NCBI-ProteinID:  WJY62786 LinkDB All DBs Position complement(682009..682269) Genome browser AA seq 86 aa AA seqDB search MTANPAHVTIYATDWCPYCRNLISRLNRTETPYELIDVDADTDAAAWVESVNNGNRVVPT VKYSDGTHATNPEASAVRRKLEELSA NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgaccgccaaccccgcgcacgtcaccatctacgccaccgactggtgcccctactgccga aacctcatcagccgccttaaccggacggaaaccccctacgagcttatcgacgtcgacgcc gacaccgatgccgccgcctgggtcgaatcggtcaacaacggcaaccgcgtcgtccccacc gtcaaatactccgacggcacccacgccaccaaccccgaggcctcggcagtgcgccgcaag ctggaagaactcagcgcttag

DBGET integrated database retrieval system