Cercocebus atys (sooty mangabey): 105573464 Help Entry 105573464         CDS       T07242                                  Symbol LTA Name (RefSeq) lymphotoxin-alpha   KO K05468   lymphotoxin alpha (TNF superfamily, member 1) Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04060   Cytokine-cytokine receptor interaction caty04061   Viral protein interaction with cytokine and cytokine receptor caty04064   NF-kappa B signaling pathway caty04668   TNF signaling pathway caty04940   Type I diabetes mellitus caty05166   Human T-cell leukemia virus 1 infection caty05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105573464 (LTA)    04668 TNF signaling pathway     105573464 (LTA)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     105573464 (LTA)    04061 Viral protein interaction with cytokine and cytokine receptor     105573464 (LTA)  09160 Human Diseases   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105573464 (LTA)    05168 Herpes simplex virus 1 infection     105573464 (LTA)   09167 Endocrine and metabolic disease    04940 Type I diabetes mellitus     105573464 (LTA)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105573464 (LTA) Cytokines and neuropeptides [BR:caty04052]  Cytokines   Tumor necrosis fators    105573464 (LTA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  TNF Motif Other DBs NCBI-GeneID:  105573464 NCBI-ProteinID:  XP_011888416 Ensembl:  ENSCATG00000042274 UniProt:  A0A2K5NPI9 LinkDB All DBs Position Unknown AA seq 205 aa AA seqDB search MTPPERLFLSRVRGTPLHLLLLGLLLVLLPGAQGLPGVGLTPSAAQTARQHPKMHLAHST LKPAAHLIGDPSKQNSLLWRANTDRAFLQDGFSLSNNSLLVPTSGIYFVYSQVVFSGKAY SPKATPTPLYLAHEVQLFSSQYPFHVPLLSSQKMVYPGLQEPWLHSMYHGAAFQLTQGDQ LSTHTDGIPHLVLSPSTVFFGAFAL NT seq 618 nt NT seq  +upstreamnt  +downstreamnt atgacaccacctgaacgtctcttcctctcaagggtgcgtggcacccccctacacctcctc cttctggggctgctgctggtcctgctgcctggggcccaggggctccctggtgttggcctc acaccttcagctgcccagactgcccgtcagcaccccaagatgcatcttgcccacagcacc ctcaaacctgctgctcacctcattggagaccccagcaagcagaactcactgctctggaga gcgaacacggaccgtgccttcctccaggatggtttctccttgagcaacaattctctcctg gtccccaccagtggcatctacttcgtctactcccaggtggtcttctctgggaaagcctac tctcctaaggccacccccaccccactctacctggcccatgaggtccagctcttctcctcc cagtaccccttccacgtgcctcttctcagctcccagaagatggtgtatccagggctgcag gaaccctggctgcactcgatgtaccatggggctgcgttccagctcacccagggagaccag ctatccacccacacagatggcatcccccacctagtcctcagccctagtactgtcttcttt ggagccttcgctctgtag

DBGET integrated database retrieval system