Cercocebus atys (sooty mangabey): 105574672 Help Entry 105574672         CDS       T07242                                  Name (RefSeq) protein S100-A10   KO K17274   protein S100-A10 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04382   Cornified envelope formation caty05132   Salmonella infection Brite KEGG Orthology (KO) [BR:caty00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     105574672  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105574672  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caty04147]     105574672 Exosome [BR:caty04147]  Exosomal proteins   Exosomal proteins of microglial cells    105574672 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  S_100 EF-hand_7 EF-hand_1 EFhand_Ca_insen EF-hand_8 EF-hand_6 TMP_3 Motif Other DBs NCBI-GeneID:  105574672 NCBI-ProteinID:  XP_011891172 Ensembl:  ENSCATG00000015601 UniProt:  A0A2K5KUS4 LinkDB All DBs Position Unknown AA seq 97 aa AA seqDB search MPSQMEHAMETMMFTFHKFAGDKGYLTKEDLRVLMEKEFPGFLENQKDPLAVDKIMKDLD QCRDGKVGFQSFFSLIAGLTIACNDYFVVHMKQKGKK NT seq 294 nt NT seq  +upstreamnt  +downstreamnt atgccgtctcaaatggagcacgccatggaaaccatgatgtttacatttcacaaattcgcg ggggataaaggctacttaacaaaggaggacctgagagtactcatggaaaaggagttccct ggatttttggaaaatcaaaaagaccctctggccgtggacaaaataatgaaggacctggac cagtgcagagatggcaaagtgggcttccagagcttcttttccctaattgcgggcctcacc attgcatgcaatgactattttgtagtacacatgaagcagaagggaaagaagtag

DBGET integrated database retrieval system