Cercocebus atys (sooty mangabey): 105575340 Help Entry 105575340         CDS       T07242                                  Name (RefSeq) ubiquitin-like   KO K02927   ubiquitin-large subunit ribosomal protein L40e Organism caty  Cercocebus atys (sooty mangabey) Pathway caty03010   Ribosome caty04120   Ubiquitin mediated proteolysis caty04137   Mitophagy - animal caty04140   Autophagy - animal caty05012   Parkinson disease caty05022   Pathways of neurodegeneration - multiple diseases caty05167   Kaposi sarcoma-associated herpesvirus infection caty05171   Coronavirus disease - COVID-19 Brite KEGG Orthology (KO) [BR:caty00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     105575340   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     105575340  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105575340    04137 Mitophagy - animal     105575340  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     105575340    05167 Kaposi sarcoma-associated herpesvirus infection     105575340   09164 Neurodegenerative disease    05012 Parkinson disease     105575340    05022 Pathways of neurodegeneration - multiple diseases     105575340  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:caty03011]     105575340    04121 Ubiquitin system [BR:caty04121]     105575340 Ribosome [BR:caty03011]  Ribosomal proteins   Eukaryotes    Large subunit     105575340   Archaea     105575340 Ubiquitin system [BR:caty04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    105575340 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ribosomal_L40e Rad60-SLD Ubiquitin_2 DUF2604 TBK1_ULD Motif Other DBs NCBI-GeneID:  105575340 NCBI-ProteinID:  XP_011892425 LinkDB All DBs Position Unknown AA seq 146 aa AA seqDB search MQIFVKTLTGKTITLEVKPSDTNEDVKAKIQDKEGIPPDQQHLLLAGKQLEDGRTLSDYD IWEESTLHLVLRLRGGIIEPSLRQLFQKHNFDKMICRKCYACLHPRAVNCCKKCDHTNNL HPKKKVKALPSSKGSLPGASIKCLFR NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atgcagatctttgtgaagacacttacgggcaagaccatcactcttgaggtcaagcccagt gacaccaatgaggatgtcaaagccaaaattcaagacaaggagggtatcccacctgaccag cagcatctgctacttgccggcaaacagctggaggatggccgaactctctcagactacgac atctgggaagagtccactctgcacctggtgctgcgcctgcgaggtggcattattgagcct tccctccgccagctcttccagaaacacaactttgacaagatgatctgccgcaagtgctat gcttgcctgcacccccgtgctgtcaactgctgcaagaagtgtgaccacaccaacaacctg caccccaagaagaaggtcaaggctcttccttcctcgaagggcagcctccctggagcctca ataaagtgtctctttcgttga

DBGET integrated database retrieval system