Cercocebus atys (sooty mangabey): 105576930 Help Entry 105576930         CDS       T07242                                  Symbol H3F3A Name (RefSeq) histone H3.3   KO K11253   histone H3 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04613   Neutrophil extracellular trap formation caty05034   Alcoholism caty05202   Transcriptional misregulation in cancer caty05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:caty00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     105576930 (H3F3A)  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     105576930 (H3F3A)   09163 Immune disease    05322 Systemic lupus erythematosus     105576930 (H3F3A)   09165 Substance dependence    05034 Alcoholism     105576930 (H3F3A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:caty03036]     105576930 (H3F3A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caty04147]     105576930 (H3F3A) Chromosome and associated proteins [BR:caty03036]  Eukaryotic type   Nucleosome assembly factors    Histones     105576930 (H3F3A) Exosome [BR:caty04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105576930 (H3F3A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CENP-T_C PAF CENP-S CBFD_NFYB_HMF TFIID-31kDa Motif Other DBs NCBI-GeneID:  105576930 NCBI-ProteinID:  XP_011895905 Ensembl:  ENSCATG00000036239 UniProt:  A0A2K5MWI8 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggctcgtacaaagcagactgcccgcaaatcgaccggtggtaaagcacccaggaagcaa ctggctacaaaagccgctcgcaagagtgcgccctctactggaggggtgaagaaacctcat cgttacaggcctggtactgtggcactccgtgaaattagacgttatcagaagtccactgaa cttctgattcgcaaacttcccttccagcgtctggtgcgagaaattgctcaggactttaaa acagatctgcgcttccagagcgcagctattggtgctttgcaggaggcaagtgaggcctat ctggttggcctttttgaagacaccaacctgtgtgctatccatgccaaacgtgtaacaatt atgccaaaagacatccagctagcacgccgcatacgtggagaacgtgcttaa

DBGET integrated database retrieval system