Cercocebus atys (sooty mangabey): 105577167 Help Entry 105577167         CDS       T07242                                  Name (RefSeq) tubulin beta-8 chain-like   KO K07375   tubulin beta Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04145   Phagosome caty04517   IgSF CAM signaling caty04540   Gap junction caty04814   Motor proteins caty05010   Alzheimer disease caty05012   Parkinson disease caty05014   Amyotrophic lateral sclerosis caty05016   Huntington disease caty05020   Prion disease caty05022   Pathways of neurodegeneration - multiple diseases caty05132   Salmonella infection Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     105577167  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     105577167   09144 Cellular community - eukaryotes    04540 Gap junction     105577167   09142 Cell motility    04814 Motor proteins     105577167  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105577167   09164 Neurodegenerative disease    05010 Alzheimer disease     105577167    05012 Parkinson disease     105577167    05014 Amyotrophic lateral sclerosis     105577167    05016 Huntington disease     105577167    05020 Prion disease     105577167    05022 Pathways of neurodegeneration - multiple diseases     105577167  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:caty03036]     105577167   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:caty04812]     105577167    04147 Exosome [BR:caty04147]     105577167 Chromosome and associated proteins [BR:caty03036]  Eukaryotic type   Centrosome formation proteins    Microtubules and associated factors     Other tubulins      105577167 Cytoskeleton proteins [BR:caty04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulins     105577167 Exosome [BR:caty04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    105577167   Exosomal proteins of colorectal cancer cells    105577167   Exosomal proteins of bladder cancer cells    105577167 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tubulin_C Het-C Motif Other DBs NCBI-GeneID:  105577167 NCBI-ProteinID:  XP_011896300 LinkDB All DBs Position Unknown AA seq 124 aa AA seqDB search MPMREVDEQMFNIQNKNSSYFADWLPHNVKTAVCDIPPRGLKMSATFIGNNTAIQELFKR VSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATAEEEEFEEYAE EEEA NT seq 375 nt NT seq  +upstreamnt  +downstreamnt atgcccatgagggaggtggatgaacaaatgttcaacattcaaaataagaacagcagctac ttcgctgactggctcccccacaatgtcaaaacagccgtctgtgacatcccaccccggggg ctaaaaatgtcagccaccttcattgggaacaacacggccatccaggagctcttcaagcgt gtctcagagcagtttacagcaatgttccggcgcaaggccttcctccattggtatacgggc gaggggatggatgagatggaatttacggaggcggagagcaacatgaacgacctggtttct gagtatcaacagtatcaggatgccacagccgaggaagaggagtttgaggaatatgctgag gaggaggaggcctag

DBGET integrated database retrieval system