Cercocebus atys (sooty mangabey): 105577261 Help Entry 105577261         CDS       T07242                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04010   MAPK signaling pathway caty04014   Ras signaling pathway caty04015   Rap1 signaling pathway caty04022   cGMP-PKG signaling pathway caty04066   HIF-1 signaling pathway caty04068   FoxO signaling pathway caty04072   Phospholipase D signaling pathway caty04081   Hormone signaling caty04114   Oocyte meiosis caty04140   Autophagy - animal caty04150   mTOR signaling pathway caty04151   PI3K-Akt signaling pathway caty04152   AMPK signaling pathway caty04211   Longevity regulating pathway caty04213   Longevity regulating pathway - multiple species caty04810   Regulation of actin cytoskeleton caty04910   Insulin signaling pathway caty04911   Insulin secretion caty04913   Ovarian steroidogenesis caty04914   Progesterone-mediated oocyte maturation caty04917   Prolactin signaling pathway caty04923   Regulation of lipolysis in adipocytes caty04930   Type II diabetes mellitus caty04931   Insulin resistance caty04932   Non-alcoholic fatty liver disease caty04940   Type I diabetes mellitus caty04950   Maturity onset diabetes of the young caty04960   Aldosterone-regulated sodium reabsorption caty05010   Alzheimer disease caty05215   Prostate cancer caty05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105577261 (INS)    04014 Ras signaling pathway     105577261 (INS)    04015 Rap1 signaling pathway     105577261 (INS)    04066 HIF-1 signaling pathway     105577261 (INS)    04068 FoxO signaling pathway     105577261 (INS)    04072 Phospholipase D signaling pathway     105577261 (INS)    04022 cGMP-PKG signaling pathway     105577261 (INS)    04151 PI3K-Akt signaling pathway     105577261 (INS)    04152 AMPK signaling pathway     105577261 (INS)    04150 mTOR signaling pathway     105577261 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     105577261 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105577261 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     105577261 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     105577261 (INS)  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     105577261 (INS)    04910 Insulin signaling pathway     105577261 (INS)    04923 Regulation of lipolysis in adipocytes     105577261 (INS)    04913 Ovarian steroidogenesis     105577261 (INS)    04914 Progesterone-mediated oocyte maturation     105577261 (INS)    04917 Prolactin signaling pathway     105577261 (INS)   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     105577261 (INS)   09149 Aging    04211 Longevity regulating pathway     105577261 (INS)    04213 Longevity regulating pathway - multiple species     105577261 (INS)  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     105577261 (INS)   09164 Neurodegenerative disease    05010 Alzheimer disease     105577261 (INS)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     105577261 (INS)   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     105577261 (INS)    04940 Type I diabetes mellitus     105577261 (INS)    04950 Maturity onset diabetes of the young     105577261 (INS)    04932 Non-alcoholic fatty liver disease     105577261 (INS)    04931 Insulin resistance     105577261 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105577261 (INS) Cytokines and neuropeptides [BR:caty04052]  Neuropeptides   Unclassified    105577261 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  105577261 NCBI-ProteinID:  XP_011896559 Ensembl:  ENSCATG00000044493 UniProt:  A0A2K5P2L3 LinkDB All DBs Position Unknown AA seq 110 aa AA seqDB search MALWMRLLPLLALLALWGPDPVPAFVNQHLCGSHLVEALYLVCGERGFFYTPKTRREAED PQVGQVELGGGPGAGSLQPLSLEGSLQKRGIVEQCCTSICSLYQLENYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggccctgtggatgcgcctcctgcccctgctggcgctgctggccctctggggacctgac ccggtcccggcctttgtgaaccagcacctgtgcggctcccacctggtggaagctctctac ctggtgtgcggggagcgaggcttcttctacacacccaagacccgccgggaggcagaggac cctcaggtggggcaggtggagctgggcgggggccccggcgcaggcagcctgcagcccttg tcgctggaggggtccctgcagaagcgcggcatcgtggagcagtgctgcaccagcatctgc tccctctaccagctggagaactactgcaactag

DBGET integrated database retrieval system