Cercocebus atys (sooty mangabey): 105578536 Help Entry 105578536         CDS       T07242                                  Symbol PFN4 Name (RefSeq) profilin-4   KO K05759   profilin Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04015   Rap1 signaling pathway caty04810   Regulation of actin cytoskeleton caty05014   Amyotrophic lateral sclerosis caty05132   Salmonella infection Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105578536 (PFN4)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105578536 (PFN4)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105578536 (PFN4)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105578536 (PFN4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caty04131]     105578536 (PFN4)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:caty04812]     105578536 (PFN4)    04147 Exosome [BR:caty04147]     105578536 (PFN4) Membrane trafficking [BR:caty04131]  Others   Actin-binding proteins    Others     105578536 (PFN4) Cytoskeleton proteins [BR:caty04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105578536 (PFN4) Exosome [BR:caty04147]  Exosomal proteins   Proteins found in most exosomes    105578536 (PFN4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105578536 NCBI-ProteinID:  XP_011899816 Ensembl:  ENSCATG00000032266 UniProt:  A0A2K5LUQ2 LinkDB All DBs Position Unknown AA seq 129 aa AA seqDB search MSHLQSLLLDTLLGTKHVDSAALIKIQERSLCVASPGFNVMPSDVRTLVNGFAKNPLQTR REGLYFKEKDYRCVRADEYSLYAKNENAGVVVVKTHLYLLVATYTEGMYPSVCVEATESL GDYLRKKGS NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgagccatttgcagagcttattgttagacaccctcttgggaaccaagcatgtggacagt gcagccctcatcaaaatccaggagcggagcctgtgtgtagcatcaccaggttttaatgta atgcccagtgatgtccgaacactggtgaatggatttgccaagaaccctttgcaaacccga agagaaggattgtatttcaaggaaaaggattacagatgtgtccgggcagatgagtattct ctttatgccaaaaatgagaacgctggtgtggttgtcgtgaagacccatctgtatcttctg gtggcaacttacactgagggcatgtatcctagtgtctgtgtggaagccacagagagcctg ggagactacctaagaaaaaaaggaagttga

DBGET integrated database retrieval system