Cercocebus atys (sooty mangabey): 105579646 Help Entry 105579646         CDS       T07242                                  Symbol GAST Name (RefSeq) gastrin   KO K13768   gastrin Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04081   Hormone signaling caty04971   Gastric acid secretion Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04081 Hormone signaling     105579646 (GAST)  09150 Organismal Systems   09154 Digestive system    04971 Gastric acid secretion     105579646 (GAST)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105579646 (GAST) Cytokines and neuropeptides [BR:caty04052]  Neuropeptides   GPCR binding    105579646 (GAST) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Gastrin Motif Other DBs NCBI-GeneID:  105579646 NCBI-ProteinID:  XP_011902016 Ensembl:  ENSCATG00000042229 UniProt:  A0A2K5NNQ0 LinkDB All DBs Position Unknown AA seq 104 aa AA seqDB search MQQLCVYVLIFALALAAFSEASWKPRSQQPDAPLGTGANRNLELPWLDQQGPASHHRRQL GPQGPPQFVADPSKKQGPWMEEEEAAYGWMDFGRRSAEDENQQP NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgcagcaactgtgtgtgtatgtgctgatctttgccctggctctggctgccttctctgaa gcttcttggaagccccgctcccagcagccagatgcacccttaggtacaggggccaacagg aacctggagctaccctggctggaccagcaaggcccagcctctcaccaccgaaggcagctg ggaccccagggtcccccacaattcgtggcagacccatccaagaagcagggaccatggatg gaggaagaagaagcagcctatggatggatggactttggccgccgcagtgccgaggatgag aaccaacaaccctag

DBGET integrated database retrieval system