KEGG   Cercocebus atys (sooty mangabey): 105580846
Entry
105580846         CDS       T07242                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
caty  Cercocebus atys (sooty mangabey)
Pathway
caty04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:caty00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    105580846 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:caty04050]
    105580846 (TNFRSF8)
   04090 CD molecules [BR:caty04090]
    105580846 (TNFRSF8)
Cytokine receptors [BR:caty04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   105580846 (TNFRSF8)
CD molecules [BR:caty04090]
 Proteins
  105580846 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 105580846
NCBI-ProteinID: XP_011904697
Ensembl: ENSCATG00000030034
LinkDB
Position
Unknown
AA seq 631 aa
MNWTERTAIRGRRFLSRLPAGLSGSWADQDRPFEDTCRGNPSHYYDKAVRRCCYRCPTGL
FPTQQCPQRPADCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKMPCAWNSSRVCECQPGM
FCAVSVVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPAPPGLSPACASPENCKEPSRI
TSPVSGFFPSGTIPQAKPTLVSPATSNASTMPLRGGTRLAQEAASKLTRAPSSPSSVGRP
SSDPGLSPTQPCPQGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRIC
ECRPGMICATSATNSCARCVPYPICAAETGTKPQDMAEKDTTFEAPPLGTQPDCSPTPEN
GEAPASTSPTLSSLVDSQASKTLPIPTSAPIALSSTGKPVLDAGPVLFWVILVLAVVVGS
STFLLCHRRACRKRIRQKLHLCYPVQTSRPKLELVDSRPRRSSTFESGTFVTKPSAEELG
LMSLPPKETCRNVGAACPESLPLWDASPAGGPSSPRDLPEPRVSTEHTNNRIEKIYIMKA
DTVIVGTVKAELPEGQGLAGPAEPELEEELEADHAPHYPEQETEPPLGSCSDAMLSVEEE
GKEDPLPTAASGKKQDCFEVPSGFGVFHISH
NT seq 1896 nt   +upstreamnt  +downstreamnt
atgaactggaccgagcgcactgccatacgcgggaggcgctttttgtcccgactacctgct
ggcctgtcggggtcctgggcagatcaggatcgacccttcgaggacacctgtcgtggaaac
cccagccactactatgacaaggctgtcaggaggtgctgttaccgctgccccacggggctg
ttcccgacacagcagtgcccacagaggcctgctgactgcaggaagcagtgtgaacctgac
tactacctggatgaggccggccgctgtacggcctgcgtgagttgttctcgagacgacctc
gtggagaagatgccgtgtgcgtggaactcctcccgtgtctgcgaatgtcagcctggcatg
ttctgtgccgtgtctgtcgtcaactcctgtgcccgctgcttcttccattctgtctgccca
gcagggatgattgtcaagttcccaggcacggcgcagaagaacacggtctgtgaaccggct
cccccagggctcagccctgcctgtgccagcccagagaactgcaaggagccctccagaatt
accagtcccgtctctggcttcttccccagtggcaccatccctcaggccaagcccaccctg
gtgtccccagcaacctccaatgccagcaccatgcctctaagagggggcacccgcctcgcc
caggaagctgcttctaaactgacaagggctcccagctctccctcctccgtgggaaggcct
agttcggatccaggtctgtccccaacgcagccgtgcccacaggggtctggcgactgcagg
aagcagtgtgagcctgactactacctggacgaggctggccgctgcacggcctgcgtgagc
tgttctcgggacgacctcgtggagaagacgccgtgtgcatggaactcctcccgcatctgc
gaatgtcgacctggcatgatctgtgccacatcagccaccaactcctgtgcccgctgtgtc
ccctacccaatctgcgcagcagagacaggcaccaagccccaggatatggctgagaaggac
accacctttgaggcgccacccctggggacccagcctgactgcagccccaccccagagaat
ggcgaggcgcctgccagtaccagccccactctgagctccctggtggactcccaggccagt
aagacgctgcccatcccaaccagcgctcccatcgctctctcctccacggggaagcccgtt
ctggatgcagggccagtgctcttctgggtgatcctggtgctggctgtggtggtcggctcc
agcaccttcctcctgtgccaccggagggcctgcaggaagcgaattcggcagaagctccac
ctgtgctacccggtccagacctcccggcccaagctagagcttgtggattccagacccagg
aggagctcaacgtttgagagtggtacgtttgtgacaaaacccagtgcggaagagctgggg
ttaatgagcctgccaccgaaggagacctgccgcaacgtgggggcagcctgcccggagagc
ctgccgctgtgggatgccagcccggccgggggcccctcgtcccccagggaccttcctgag
ccccgggtgtccacggagcacaccaataacaggattgagaaaatctacatcatgaaggcc
gacactgtgatcgtgggaactgtgaaggctgagctgccagagggccagggcctggcgggg
ccggcagagcccgagttggaggaggagctggaggcggaccatgccccccactaccccgag
caggagacagaaccgcctctgggcagctgcagtgatgccatgctgtcggtggaggaggaa
gggaaagaagaccccttgcccacagctgcctctggaaagaaacaagactgtttcgaggtt
ccatcaggatttggggtgtttcacatttcacactaa

DBGET integrated database retrieval system