Cercocebus atys (sooty mangabey): 105581939 Help Entry 105581939         CDS       T07242                                  Symbol FGF16 Name (RefSeq) fibroblast growth factor 16   KO K04358   fibroblast growth factor Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04010   MAPK signaling pathway caty04014   Ras signaling pathway caty04015   Rap1 signaling pathway caty04020   Calcium signaling pathway caty04151   PI3K-Akt signaling pathway caty04810   Regulation of actin cytoskeleton caty05200   Pathways in cancer caty05207   Chemical carcinogenesis - receptor activation caty05218   Melanoma caty05224   Breast cancer caty05226   Gastric cancer Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     105581939 (FGF16)    04014 Ras signaling pathway     105581939 (FGF16)    04015 Rap1 signaling pathway     105581939 (FGF16)    04020 Calcium signaling pathway     105581939 (FGF16)    04151 PI3K-Akt signaling pathway     105581939 (FGF16)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105581939 (FGF16)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105581939 (FGF16)    05207 Chemical carcinogenesis - receptor activation     105581939 (FGF16)   09162 Cancer: specific types    05226 Gastric cancer     105581939 (FGF16)    05218 Melanoma     105581939 (FGF16)    05224 Breast cancer     105581939 (FGF16)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:caty04052]     105581939 (FGF16)    00536 Glycosaminoglycan binding proteins [BR:caty00536]     105581939 (FGF16) Cytokines and neuropeptides [BR:caty04052]  Cytokines   Growth factors (RTK binding)    105581939 (FGF16) Glycosaminoglycan binding proteins [BR:caty00536]  Heparan sulfate / Heparin   Growth factors/receptors    105581939 (FGF16) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  FGF Motif Other DBs NCBI-GeneID:  105581939 NCBI-ProteinID:  XP_011907173 Ensembl:  ENSCATG00000030507 UniProt:  A0A2K5LIG0 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MAEVGGVFASLDWDLHGFSSSLGNVPLADSPGFLNERLGQIEGKLQRGSPTDFAHLKGIL RRRQLYCRTGFHLEIFPNGTVHGTRHDHSRFGILEFISLAVGLISIRGVDSGLYLGMNER GELYGSKKLTRECVFREQFEENWYNTYASTLYKHSDSERQYYVALNKDGSPREGYRTKRH QKFTHFLPRPVDPSKLPSMSRDLFHYR NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcagaggtggggggcgtcttcgcctccttggactgggatctacatggcttctcctcg tctctggggaacgtgcccttagctgactccccaggtttcctgaacgagcgcctgggccaa atcgaggggaagctgcagcgtggctcacccacagacttcgcccacctgaaggggatcctg cggcgccgccagctctactgccgcactggcttccacctggagatcttccccaacggcacg gtgcacggcacccgccacgaccacagccgcttcggtatcctggagtttattagcctggct gtggggctgatcagcatccggggagtggactctggtctgtacctaggaatgaacgagcga ggagaactctatgggtcgaagaaactcacacgtgaatgtgttttccgggaacagtttgaa gaaaactggtacaacacctatgcctcaaccttgtacaaacattcggactcggagagacag tattacgtagccctgaataaagacggctcaccccgggagggatacaggactaaacgacac cagaaattcactcactttttacccaggcctgtagatccttctaagttgccctccatgtcc agagacctctttcactataggtaa

DBGET integrated database retrieval system