Cercocebus atys (sooty mangabey): 105582236 Help Entry 105582236         CDS       T07242                                  Symbol BCL2L1 Name (RefSeq) bcl-2-like protein 1 isoform X1   KO K04570   Bcl-2-like 1 (apoptosis regulator Bcl-X) Organism caty  Cercocebus atys (sooty mangabey) Pathway caty01521   EGFR tyrosine kinase inhibitor resistance caty01524   Platinum drug resistance caty04014   Ras signaling pathway caty04064   NF-kappa B signaling pathway caty04115   p53 signaling pathway caty04137   Mitophagy - animal caty04140   Autophagy - animal caty04151   PI3K-Akt signaling pathway caty04210   Apoptosis caty04215   Apoptosis - multiple species caty04621   NOD-like receptor signaling pathway caty04630   JAK-STAT signaling pathway caty05012   Parkinson disease caty05014   Amyotrophic lateral sclerosis caty05022   Pathways of neurodegeneration - multiple diseases caty05145   Toxoplasmosis caty05162   Measles caty05166   Human T-cell leukemia virus 1 infection caty05168   Herpes simplex virus 1 infection caty05170   Human immunodeficiency virus 1 infection caty05200   Pathways in cancer caty05202   Transcriptional misregulation in cancer caty05212   Pancreatic cancer caty05220   Chronic myeloid leukemia caty05222   Small cell lung cancer caty05225   Hepatocellular carcinoma caty05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     105582236 (BCL2L1)    04630 JAK-STAT signaling pathway     105582236 (BCL2L1)    04064 NF-kappa B signaling pathway     105582236 (BCL2L1)    04151 PI3K-Akt signaling pathway     105582236 (BCL2L1)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     105582236 (BCL2L1)    04137 Mitophagy - animal     105582236 (BCL2L1)   09143 Cell growth and death    04210 Apoptosis     105582236 (BCL2L1)    04215 Apoptosis - multiple species     105582236 (BCL2L1)    04115 p53 signaling pathway     105582236 (BCL2L1)  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     105582236 (BCL2L1)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105582236 (BCL2L1)    05202 Transcriptional misregulation in cancer     105582236 (BCL2L1)   09162 Cancer: specific types    05212 Pancreatic cancer     105582236 (BCL2L1)    05225 Hepatocellular carcinoma     105582236 (BCL2L1)    05220 Chronic myeloid leukemia     105582236 (BCL2L1)    05222 Small cell lung cancer     105582236 (BCL2L1)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105582236 (BCL2L1)    05170 Human immunodeficiency virus 1 infection     105582236 (BCL2L1)    05162 Measles     105582236 (BCL2L1)    05168 Herpes simplex virus 1 infection     105582236 (BCL2L1)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105582236 (BCL2L1)   09164 Neurodegenerative disease    05012 Parkinson disease     105582236 (BCL2L1)    05014 Amyotrophic lateral sclerosis     105582236 (BCL2L1)    05022 Pathways of neurodegeneration - multiple diseases     105582236 (BCL2L1)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105582236 (BCL2L1)   09176 Drug resistance: antineoplastic    01521 EGFR tyrosine kinase inhibitor resistance     105582236 (BCL2L1)    01524 Platinum drug resistance     105582236 (BCL2L1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:caty01009]     105582236 (BCL2L1)   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:caty03036]     105582236 (BCL2L1)   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:caty02000]     105582236 (BCL2L1) Protein phosphatases and associated proteins [BR:caty01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Protein phosphatase-1     PP1-interacting proteins (PIPs)      105582236 (BCL2L1) Chromosome and associated proteins [BR:caty03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     105582236 (BCL2L1) Transporters [BR:caty02000]  Other transporters   Pores ion channels [TC:1]    105582236 (BCL2L1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bcl-2 BH4 Bcl-2_3 Motif Other DBs NCBI-GeneID:  105582236 NCBI-ProteinID:  XP_011907830 Ensembl:  ENSCATG00000034423 UniProt:  A0A2K5M8B1 LinkDB All DBs Position Unknown AA seq 233 aa AA seqDB search MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLV DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP WIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK NT seq 702 nt NT seq  +upstreamnt  +downstreamnt atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa ggatacagctggagtcaatttagtgatgtggaagagaacaggactgaggccccagaaggg actgaatcggagatggagacccccagtgccatcaatggcaacccatcctggcacctggtg gacagccccgcggtgaatggagccactggccacagcagcagtttggatgcccgggaggtg atccccatggcagcagtaaagcaagcgctgagggaggcaggcgacgagtttgaactgcgg taccggcgggcgttcagtgacctgacatcccagctccacatcaccccagggacagcatat cagagctttgaacaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt gtggcctttttctccttcggcggggcactgtgcgtggaaagcgtagacaaggagatgcag gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct tggatccaggagaacggcggctgggacacttttgtggaactctatgggaacaatgcagca gccgagagccgaaagggccaggagcgcttcaaccgctggttcctgacgggcatgactgtg gccggcgtggttctgctgggctcactcttcagtcggaaatga

DBGET integrated database retrieval system