KEGG   Cercocebus atys (sooty mangabey): 105582640
Entry
105582640         CDS       T07242                                 
Symbol
TP53AIP1
Name
(RefSeq) p53-regulated apoptosis-inducing protein 1 isoform X1
  KO
K13773  p53-regulated apoptosis-inducing protein 1
Organism
caty  Cercocebus atys (sooty mangabey)
Pathway
caty04115  p53 signaling pathway
caty04210  Apoptosis
Brite
KEGG Orthology (KO) [BR:caty00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    105582640 (TP53AIP1)
   04115 p53 signaling pathway
    105582640 (TP53AIP1)
SSDB
Motif
Pfam: TPIP1
Other DBs
NCBI-GeneID: 105582640
NCBI-ProteinID: XP_011908764
LinkDB
Position
Unknown
AA seq 314 aa
MGSSSKASFRSAQASGSGARRQGLGRGDQSLSMMPPNGRAQTHTPDWGSPRSEKRDSLLP
AVALRRLCSHRGADIPSFQTRQDPVTASVSPAQGTGWSWELTALINSPKRKASPLPPRNP
GFLEGKRFSEKQGFWKEGGTWLGVQKGELNGEAEQRTHVERMGRGGWGAGLRVCSSVSIP
DPAFVQMGLRAAVTYSKKPFPVANHEDDALGSLWALRRGRDAAAMHSSQHRQRVAPETDT
GWAWPRSLPGARSICTSLEAQASLPRSSKITQRLKCRAQVCWSDKAPSCGDGREGGSAGF
CLFFGRICCLCLCL
NT seq 945 nt   +upstreamnt  +downstreamnt
atggggtcttcctctaaggcgagcttcagatctgctcaagcttccggcagtggggccagg
aggcagggcctgggcaggggagaccagagcctctcgatgatgcctcccaacggcagggct
cagacacacacaccggactggggaagcccccgcagtgaaaagcgagacagtcttttgcct
gcagtggccctgcgcagactctgctctcaccgtggtgctgacatcccaagttttcagact
cgccaggacccagtgacagcatctgtgtccccagctcagggcactggatggagctgggaa
ctgacagccctgatcaatagtcccaagagaaaggccagtcctcttcctcctcggaatcct
gggtttctagaaggcaaaaggttttctgagaaacaaggcttttggaaggaaggcggtacc
tggctgggcgttcagaaaggagagttaaatggagaggctgaacagaggacacatgtggaa
cgcatggggaggggaggctggggcgcagggctccgggtctgctcttctgtgtccatcccg
gatcctgcttttgtccagatgggcctcagagcagcagtcacttactccaagaagccattt
cccgtggccaatcatgaagatgacgcactcggaagcttgtgggctctgaggagggggagg
gacgcagcggccatgcattcatcccagcacaggcagcgcgtggctccggaaacagacaca
ggctgggcctggcccaggagtctgccaggagccaggagcatctgcacctccctggaggcc
caggcttctctccccagaagctcaaaaatcacgcagcgtctgaagtgcagggcgcaggtg
tgctggagtgacaaagccccgagctgtggtgatgggagggagggaggaagcgccggtttt
tgtctgttctttgggcggatttgctgtctctgtctttgtctctaa

DBGET integrated database retrieval system