Cercocebus atys (sooty mangabey): 105583310 Help Entry 105583310         CDS       T07242                                  Symbol PFN1 Name (RefSeq) profilin-1   KO K05759   profilin Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04015   Rap1 signaling pathway caty04810   Regulation of actin cytoskeleton caty05014   Amyotrophic lateral sclerosis caty05132   Salmonella infection Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     105583310 (PFN1)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     105583310 (PFN1)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105583310 (PFN1)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     105583310 (PFN1)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caty04131]     105583310 (PFN1)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:caty04812]     105583310 (PFN1)    04147 Exosome [BR:caty04147]     105583310 (PFN1) Membrane trafficking [BR:caty04131]  Others   Actin-binding proteins    Others     105583310 (PFN1) Cytoskeleton proteins [BR:caty04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      105583310 (PFN1) Exosome [BR:caty04147]  Exosomal proteins   Proteins found in most exosomes    105583310 (PFN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  105583310 NCBI-ProteinID:  XP_011910329 Ensembl:  ENSCATG00000027796 UniProt:  A0A2K5L852 LinkDB All DBs Position Unknown AA seq 140 aa AA seqDB search MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFY VNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVH GGLINKKCYEMASHLRRSQY NT seq 423 nt NT seq  +upstreamnt  +downstreamnt atggccgggtggaacgcctacatcgataacctcatggcggacgggacctgtcaggacgcg gccatcgtgggttacaaggactcgccctccgtctgggccgccgtccccgggaaaaccttc gtcaacatcacgccagctgaggtgggtgtcctggttggcaaagaccggtcaagtttttac gtcaatgggctgacacttgggggccagaaatgttcggtgatccgggactcactgctgcag gatggggagtttagcatggatcttcgtaccaagagcaccggtggggcccccaccttcaat gtcactgtcaccaagactgacaagacgctagtcctgctgatgggcaaagaaggtgtccac ggtggtttgatcaacaagaaatgttatgaaatggcctcccaccttcggcgctcccagtac tga

DBGET integrated database retrieval system