Cercocebus atys (sooty mangabey): 105583458 Help Entry 105583458         CDS       T07242                                  Name (RefSeq) metallothionein-1F   KO K14739   metallothionein 1/2 Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04978   Mineral absorption Brite KEGG Orthology (KO) [BR:caty00001]  09150 Organismal Systems   09154 Digestive system    04978 Mineral absorption     105583458  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:caty03019]     105583458    03029 Mitochondrial biogenesis [BR:caty03029]     105583458 Messenger RNA biogenesis [BR:caty03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      105583458 Mitochondrial biogenesis [BR:caty03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     105583458 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  105583458 NCBI-ProteinID:  XP_011910654 Ensembl:  ENSCATG00000007387 UniProt:  A0A2K5KLL8 LinkDB All DBs Position Unknown AA seq 61 aa AA seqDB search MDPNCSCTAGVSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCVCKGASEKCSCC A NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atggaccccaactgctcctgcaccgctggtgtctcctgcacgtgcgccggctcctgcaag tgcaaagagtgcaaatgcacctcctgcaagaagagctgctgctcctgctgccccgtgggc tgtgccaagtgtgcccagggctgtgtctgcaaaggggcgtcggagaagtgcagctgctgt gcatga

DBGET integrated database retrieval system