Cercocebus atys (sooty mangabey): 105585865 Help Entry 105585865         CDS       T07242                                  Symbol RAB7A Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04137   Mitophagy - animal caty04140   Autophagy - animal caty04144   Endocytosis caty04145   Phagosome caty04148   Efferocytosis caty05132   Salmonella infection caty05146   Amoebiasis caty05152   Tuberculosis Brite KEGG Orthology (KO) [BR:caty00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     105585865 (RAB7A)    04145 Phagosome     105585865 (RAB7A)    04140 Autophagy - animal     105585865 (RAB7A)    04137 Mitophagy - animal     105585865 (RAB7A)    04148 Efferocytosis     105585865 (RAB7A)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     105585865 (RAB7A)    05152 Tuberculosis     105585865 (RAB7A)   09174 Infectious disease: parasitic    05146 Amoebiasis     105585865 (RAB7A)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:caty04131]     105585865 (RAB7A)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:caty04147]     105585865 (RAB7A)    04031 GTP-binding proteins [BR:caty04031]     105585865 (RAB7A) Membrane trafficking [BR:caty04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     105585865 (RAB7A) Exosome [BR:caty04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    105585865 (RAB7A)   Exosomal proteins of other body fluids (saliva and urine)    105585865 (RAB7A)   Exosomal proteins of colorectal cancer cells    105585865 (RAB7A)   Exosomal proteins of bladder cancer cells    105585865 (RAB7A) GTP-binding proteins [BR:caty04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     105585865 (RAB7A) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU RsgA_GTPase Gtr1_RagA ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_22 AAA_16 AAA_24 G-alpha AAA_5 ATPase_2 NACHT AAA_14 NB-ARC SRPRB ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  105585865 NCBI-ProteinID:  XP_011915759 Ensembl:  ENSCATG00000041773 UniProt:  A0A2K5NLF8 LinkDB All DBs Position Unknown AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDKNDRAKASAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacctctaggaagaaagtgttgctgaaggttatcatcctgggagattctggagtcggg aagacatcactcatgaaccagtatgtgaataagaaattcagcaatcagtacaaagccaca ataggagctgactttctgaccaaggaggtgatggtggatgacagactagtcacaatgcag atatgggacacagcaggacaggaacggttccagtctcttggtgtggccttctacagaggt gcagactgctgtgttctggtatttgatgtgactgcccccaacacattcaaaaccctagat agctggagagatgagtttctcatccaggccagtccccgagatcctgaaaacttccccttt gttgtgttgggaaacaagattgacctcgaaaacagacaagtggccacaaagcgggcacag gcctggtgctacagcaaaaacaacattccctactttgagaccagtgccaaggaggccatc aacgtggagcaggcgttccagacgattgcacggaatgcacttaagcaggaaacggaggtg gagctgtacaacgaattccctgaacctatcaaactggacaagaatgaccgggccaaggcc tcggcagaaagctgcagttgctga

DBGET integrated database retrieval system