Cercocebus atys (sooty mangabey): 105589068 Help Entry 105589068         CDS       T07242                                  Symbol NFKBIA Name (RefSeq) NF-kappa-B inhibitor alpha   KO K04734   NF-kappa-B inhibitor alpha Organism caty  Cercocebus atys (sooty mangabey) Pathway caty04024   cAMP signaling pathway caty04062   Chemokine signaling pathway caty04064   NF-kappa B signaling pathway caty04210   Apoptosis caty04380   Osteoclast differentiation caty04620   Toll-like receptor signaling pathway caty04621   NOD-like receptor signaling pathway caty04622   RIG-I-like receptor signaling pathway caty04623   Cytosolic DNA-sensing pathway caty04625   C-type lectin receptor signaling pathway caty04657   IL-17 signaling pathway caty04658   Th1 and Th2 cell differentiation caty04659   Th17 cell differentiation caty04660   T cell receptor signaling pathway caty04662   B cell receptor signaling pathway caty04668   TNF signaling pathway caty04722   Neurotrophin signaling pathway caty04920   Adipocytokine signaling pathway caty04926   Relaxin signaling pathway caty04931   Insulin resistance caty04936   Alcoholic liver disease caty05132   Salmonella infection caty05134   Legionellosis caty05135   Yersinia infection caty05140   Leishmaniasis caty05142   Chagas disease caty05145   Toxoplasmosis caty05160   Hepatitis C caty05161   Hepatitis B caty05162   Measles caty05163   Human cytomegalovirus infection caty05164   Influenza A caty05166   Human T-cell leukemia virus 1 infection caty05167   Kaposi sarcoma-associated herpesvirus infection caty05168   Herpes simplex virus 1 infection caty05169   Epstein-Barr virus infection caty05170   Human immunodeficiency virus 1 infection caty05171   Coronavirus disease - COVID-19 caty05200   Pathways in cancer caty05203   Viral carcinogenesis caty05208   Chemical carcinogenesis - reactive oxygen species caty05215   Prostate cancer caty05220   Chronic myeloid leukemia caty05222   Small cell lung cancer caty05235   PD-L1 expression and PD-1 checkpoint pathway in cancer caty05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:caty00001]  09130 Environmental Information Processing   09132 Signal transduction    04064 NF-kappa B signaling pathway     105589068 (NFKBIA)    04668 TNF signaling pathway     105589068 (NFKBIA)    04024 cAMP signaling pathway     105589068 (NFKBIA)  09140 Cellular Processes   09143 Cell growth and death    04210 Apoptosis     105589068 (NFKBIA)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     105589068 (NFKBIA)    04621 NOD-like receptor signaling pathway     105589068 (NFKBIA)    04622 RIG-I-like receptor signaling pathway     105589068 (NFKBIA)    04623 Cytosolic DNA-sensing pathway     105589068 (NFKBIA)    04625 C-type lectin receptor signaling pathway     105589068 (NFKBIA)    04660 T cell receptor signaling pathway     105589068 (NFKBIA)    04658 Th1 and Th2 cell differentiation     105589068 (NFKBIA)    04659 Th17 cell differentiation     105589068 (NFKBIA)    04657 IL-17 signaling pathway     105589068 (NFKBIA)    04662 B cell receptor signaling pathway     105589068 (NFKBIA)    04062 Chemokine signaling pathway     105589068 (NFKBIA)   09152 Endocrine system    04920 Adipocytokine signaling pathway     105589068 (NFKBIA)    04926 Relaxin signaling pathway     105589068 (NFKBIA)   09156 Nervous system    04722 Neurotrophin signaling pathway     105589068 (NFKBIA)   09158 Development and regeneration    04380 Osteoclast differentiation     105589068 (NFKBIA)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     105589068 (NFKBIA)    05208 Chemical carcinogenesis - reactive oxygen species     105589068 (NFKBIA)    05203 Viral carcinogenesis     105589068 (NFKBIA)    05235 PD-L1 expression and PD-1 checkpoint pathway in cancer     105589068 (NFKBIA)   09162 Cancer: specific types    05220 Chronic myeloid leukemia     105589068 (NFKBIA)    05215 Prostate cancer     105589068 (NFKBIA)    05222 Small cell lung cancer     105589068 (NFKBIA)   09172 Infectious disease: viral    05166 Human T-cell leukemia virus 1 infection     105589068 (NFKBIA)    05170 Human immunodeficiency virus 1 infection     105589068 (NFKBIA)    05161 Hepatitis B     105589068 (NFKBIA)    05160 Hepatitis C     105589068 (NFKBIA)    05171 Coronavirus disease - COVID-19     105589068 (NFKBIA)    05164 Influenza A     105589068 (NFKBIA)    05162 Measles     105589068 (NFKBIA)    05168 Herpes simplex virus 1 infection     105589068 (NFKBIA)    05163 Human cytomegalovirus infection     105589068 (NFKBIA)    05167 Kaposi sarcoma-associated herpesvirus infection     105589068 (NFKBIA)    05169 Epstein-Barr virus infection     105589068 (NFKBIA)   09171 Infectious disease: bacterial    05132 Salmonella infection     105589068 (NFKBIA)    05135 Yersinia infection     105589068 (NFKBIA)    05134 Legionellosis     105589068 (NFKBIA)   09174 Infectious disease: parasitic    05145 Toxoplasmosis     105589068 (NFKBIA)    05140 Leishmaniasis     105589068 (NFKBIA)    05142 Chagas disease     105589068 (NFKBIA)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     105589068 (NFKBIA)   09167 Endocrine and metabolic disease    04936 Alcoholic liver disease     105589068 (NFKBIA)    04931 Insulin resistance     105589068 (NFKBIA)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03000 Transcription factors [BR:caty03000]     105589068 (NFKBIA)    04131 Membrane trafficking [BR:caty04131]     105589068 (NFKBIA) Transcription factors [BR:caty03000]  Eukaryotic type   beta-Scaffold factors with minor groove contacts    RHR (Rel homology region) Ankyrin only     105589068 (NFKBIA) Membrane trafficking [BR:caty04131]  Autophagy   Chaperone mediated autophagy (CMA)    Selective cargos     105589068 (NFKBIA) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ank_2 Ank Ank_3 Ank_5 Ank_4 ANK_LRRK2 Motif Other DBs NCBI-GeneID:  105589068 NCBI-ProteinID:  XP_011922518 Ensembl:  ENSCATG00000041261 UniProt:  A0A2K5NHS4 LinkDB All DBs Position Unknown AA seq 317 aa AA seqDB search MFQAAERPQEWAMEGPRDGLKKERLLDDRHDSGLDSMKDEEYEQMVKELQEIRLEPQEVP RGAEPWKQQLTEDGDSFLHLAIIHEEKALTMEVIRQVKGDLAFLNFQNNLQQTPLHLAVI TNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQGCLASVGVLTQSCTTPHLHSILKATN YNGHTCLHLASIHGYLGIVELLVSLGADVNAQEPCNGRTALHLAVDLQNPDLVSLLLKCG ADVNRVTYQGYSPYQLTWGRPSTRIQQQLGQLTLENLQMLPESEDEESYDTESEFTEFTE DELPYDDCVFGGQRLTL NT seq 954 nt NT seq  +upstreamnt  +downstreamnt atgttccaggcggccgagcgcccccaggagtgggccatggagggtccccgcgacgggctg aagaaggaacgactgctggacgaccgccacgacagcggcctggactccatgaaggatgag gagtacgagcagatggtcaaggagctgcaggagatccgcctcgagccgcaggaggtgccg cgcggcgcggagccctggaagcagcagctcaccgaggacggggactcgtttctgcacttg gccatcatccatgaagaaaaggcactgaccatggaagtgatccgccaggtgaagggagac ctggccttcctcaacttccagaacaacctgcagcagactccactccacttggctgtgatc accaaccagccagaaattgctgaggcacttctgggagctggctgtgatcctgagctccga gactttcgaggaaatacccccctacaccttgcctgtgagcagggctgcttggccagcgtg ggagtcctgactcagtcctgcaccaccccacacctccactccatcctgaaggctaccaac tacaatggccacacgtgtctgcacttagcctctatccatggctacctgggcattgtggag cttttggtgtccttgggtgctgatgtcaatgctcaggagccctgtaacggccggactgcc cttcacctcgcagtggacctgcagaatcctgacctggtgtcgctcctgttgaagtgtggg gctgatgtcaacagagttacctaccagggctattctccctaccagctcacctggggccgc ccaagcacccggatacagcagcagctgggccagctgacgctggaaaaccttcagatgctg ccggagagtgaggatgaggagagctatgacacagagtcagagttcacggagttcacggag gatgagctgccctatgacgactgtgtgtttggaggccagcgtctgacattatga

DBGET integrated database retrieval system